OSCA017079-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA017079-RA
Unique NameOSCA017079-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length543
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25769contignewscf_25769:15..1249 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.24
QI0|0|0|1|1|1|3|0|181
AED0.24
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA017079OSCA017079Ostrinia scapulalisgenenewscf_25769 15..1249 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017079-RAOSCA017079-PAOstrinia scapulalispolypeptidenewscf_25769 15..1249 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017079-RA:cdsOSCA017079-RA:cdsOstrinia scapulalisCDSnewscf_25769 15..77 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017079-RA:exon:2492OSCA017079-RA:exon:2492Ostrinia scapulalisexonnewscf_25769 15..77 -
OSCA017079-RA:exon:2493OSCA017079-RA:exon:2493Ostrinia scapulalisexonnewscf_25769 123..452 -
OSCA017079-RA:exon:2494OSCA017079-RA:exon:2494Ostrinia scapulalisexonnewscf_25769 1100..1249 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA017079-RA ID=OSCA017079-RA|Name=OSCA017079-RA|organism=Ostrinia scapulalis|type=mRNA|length=543bp
ATGTTTCGACAAAGCGACCTGTGGCATTCCATGTGCCGTAAGATGGAGGC
ACTTTACGGGGAACTAGCGGAGTACTTCGTGTTTGACCCTCAGAAGTACG
CTTTGGAGGAATTCTTCGCTGATGTCAAGACCTTCAAGGACTCTTTCACG
AGCGAGATAGGAGATAGATCGTATTTGATCACTGTCCTAGTTTCTAGAAA
TCTGTATCTTAGTCCTAAAGAACGTAAGATGGGGTCGAAAAAGCGAGACA
AAAACAGAAATGGAGACTACACATTNTTGTTGCAAAGTCGCCTCTATAGC
AACGACATAAGGCACAGTGTCGCCAAAGAGACGCGCTCTCAGTGCGACCT
GCTTCACTCCATGTGCCGCAAGATGGAGGCACTTTACGGGGAACTAGCGG
AGTACTTCGTGTTCGACCCTCAGAAGTACGCTTTGGAGGAATTCTTCGCT
GATGTCAAGACCTTCAAGGACTCTTTCACGGGAGAGCGAGAGAGACGTCG
GCAGAACGAGACGGAAGAAGATATAGACTTTCAGACTCCTTTA
back to top

spliced messenger RNA

>OSCA017079-RA ID=OSCA017079-RA|Name=OSCA017079-RA|organism=Ostrinia scapulalis|type=mRNA|length=543bp|location=Sequence derived from alignment at newscf_25769:15..1249- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGTTTCGACAAAGCGACCTGTGGCATTCCATGTGCCGTAAGATGGAGGC
ACTTTACGGGGAACTAGCGGAGTACTTCGTGTTTGACCCTCAGAAGTACG
CTTTGGAGGAATTCTTCGCTGATGTCAAGACCTTCAAGGACTCTTTCACG
AGCGAGATAGGAGATAGATCGTATTTGATCACTGTCCTAGTTTCTAGAAA
TCTGTATCTTAGTCCTAAAGAACGTAAGATGGGGTCGAAAAAGCGAGACA
AAAACAGAAATGGAGACTACACATTMTTGTTGCAAAGTCGCCTCTATAGC
AACGACATAAGGCACAGTGTCGCCAAAGAGACGCGCTCTCAGTGCGACCT
GCTTCACTCCATGTGCCGCAAGATGGAGGCACTTTACGGGGAACTAGCGG
AGTACTTCGTGTTCGACCCTCAGAAGTACGCTTTGGAGGAATTCTTCGCT
GATGTCAAGACCTTCAAGGACTCTTTCACGGGAGAGCGAGAGAGACGTCG
GCAGAACGAGACGGAAGAAGATATAGACTTTCAGACTCCTTTA
back to top

protein sequence of OSCA017079-RA

>OSCA017079-PA ID=OSCA017079-PA|Name=OSCA017079-RA|organism=Ostrinia scapulalis|type=polypeptide|length=181bp
MFRQSDLWHSMCRKMEALYGELAEYFVFDPQKYALEEFFADVKTFKDSFT
SEIGDRSYLITVLVSRNLYLSPKERKMGSKKRDKNRNGDYTXLLQSRLYS
NDIRHSVAKETRSQCDLLHSMCRKMEALYGELAEYFVFDPQKYALEEFFA
DVKTFKDSFTGERERRRQNETEEDIDFQTPL
back to top

mRNA from alignment at newscf_25769:15..1249-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA017079-RA ID=OSCA017079-RA|Name=OSCA017079-RA|organism=Ostrinia scapulalis|type=mRNA|length=1235bp|location=Sequence derived from alignment at newscf_25769:15..1249- (Ostrinia scapulalis)
ATGTTTCGACAAAGCGACCTGTGGCATTCCATGTGCCGTAAGATGGAGGC ACTTTACGGGGAACTAGCGGAGTACTTCGTGTTTGACCCTCAGAAGTACG CTTTGGAGGAATTCTTCGCTGATGTCAAGACCTTCAAGGACTCTTTCACG GTAAGATATTAGTTAGAGGCACGTACAATAGATAGGGAGATATGGGGAGA GCGAGAGAGACGTCGGCAGAACGAGACGGACGGAGATATAGACCTTCAGA GAAGCCTTTACGGTGAGTTGACATTTTGACAAACATTTTTACTTTTTTAG CTACATAGGGACACGGTGAGAGCGAGAGGGGTATAAGCTGGAAGAGAGAG AGACAAAGACTCCTTCACGGCGGGACTTCTGAGCGAGAGAAATGTAGGTA GAGGTGTAGGCAGAACGAGACGGAAGATATAAGGACCTTTTGTGACTCCT TCAAGGTAAAATGTACATTGGGAGTGAGAGAGGCTTGGTCAGAGCGAGAG GTTAGTTAGAGAGAAAGTGACAGCAAGACCTTCATGGCGAGATATTACTT GAGACTTAATAGGGAGAGAGCGAGAAACTTGTAACTAAAACGAGACGGAG GAATATATGAACCTTCAGAGATTTTAACGGTGAGAGGCGTGGTTAGAGCG AGACGGAGAGAGACAGCAATACCTTCATGGTGAGATATTAGGTACTTATA GGGGACATGAGGAGAGCAACAAACTGTCATAAATACTTTTAAATACTTCT TTAGGGTGCGATAAGACATGAGGAGAGAGCGAGACAGGTGTATGCAGAGC GAGATAGGAGATAGATCGTATTTGATCACTGTCCTAGTTTCTAGAAATCT GTATCTTAGTCCTAAAGAACGTAAGATGGGGTCGAAAAAGCGAGACAAAA ACAGAAATGGAGACTACACATTMTTGTTGCAAAGTCGCCTCTATAGCAAC GACATAAGGCACAGTGTCGCCAAAGAGACGCGCTCTCAGTGCGACCTGCT TCACTCCATGTGCCGCAAGATGGAGGCACTTTACGGGGAACTAGCGGAGT ACTTCGTGTTCGACCCTCAGAAGTACGCTTTGGAGGAATTCTTCGCTGAT GTCAAGACCTTCAAGGACTCTTTCACGGTGAGATATTAGTTAGAGACACG TACTAAAGATAGGGAGATAAAGGGAGAGCGAGAGAGACGTCGGCAGAACG AGACGGAAGAAGATATAGACTTTCAGACTCCTTTA
back to top

Coding sequence (CDS) from alignment at newscf_25769:15..1249-

>OSCA017079-RA ID=OSCA017079-RA|Name=OSCA017079-RA|organism=Ostrinia scapulalis|type=CDS|length=543bp|location=Sequence derived from alignment at newscf_25769:15..1249- (Ostrinia scapulalis)
ATGTTTCGACAAAGCGACCTGTGGCATTCCATGTGCCGTAAGATGGAGGC
ACTTTACGGGGAACTAGCGGAGTACTTCGTGTTTGACCCTCAGAAGTACG
CTTTGGAGGAATTCTTCGCTGATGTCAAGACCTTCAAGGACTCTTTCACG
AGCGAGATAGGAGATAGATCGTATTTGATCACTGTCCTAGTTTCTAGAAA
TCTGTATCTTAGTCCTAAAGAACGTAAGATGGGGTCGAAAAAGCGAGACA
AAAACAGAAATGGAGACTACACATTMTTGTTGCAAAGTCGCCTCTATAGC
AACGACATAAGGCACAGTGTCGCCAAAGAGACGCGCTCTCAGTGCGACCT
GCTTCACTCCATGTGCCGCAAGATGGAGGCACTTTACGGGGAACTAGCGG
AGTACTTCGTGTTCGACCCTCAGAAGTACGCTTTGGAGGAATTCTTCGCT
GATGTCAAGACCTTCAAGGACTCTTTCACGGGAGAGCGAGAGAGACGTCG
GCAGAACGAGACGGAAGAAGATATAGACTTTCAGACTCCTTTA
back to top
Synonyms
The feature 'OSCA017079-RA' has the following synonyms
Synonym
maker-newscf_25769-augustus-gene-0.4-mRNA-1