OSCA017397-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA017397-RA
Unique NameOSCA017397-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length603
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1246contignewscf_1246:374..5535 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.22
QI0|0|0|0.83|0.8|0.83|6|0|200
AED0.22
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA017397OSCA017397Ostrinia scapulalisgenenewscf_1246 374..5535 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017397-RAOSCA017397-PAOstrinia scapulalispolypeptidenewscf_1246 374..5535 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017397-RA:exon:524OSCA017397-RA:exon:524Ostrinia scapulalisexonnewscf_1246 374..484 +
OSCA017397-RA:exon:525OSCA017397-RA:exon:525Ostrinia scapulalisexonnewscf_1246 3196..3328 +
OSCA017397-RA:exon:526OSCA017397-RA:exon:526Ostrinia scapulalisexonnewscf_1246 3849..3973 +
OSCA017397-RA:exon:527OSCA017397-RA:exon:527Ostrinia scapulalisexonnewscf_1246 4640..4708 +
OSCA017397-RA:exon:528OSCA017397-RA:exon:528Ostrinia scapulalisexonnewscf_1246 4975..5098 +
OSCA017397-RA:exon:529OSCA017397-RA:exon:529Ostrinia scapulalisexonnewscf_1246 5495..5535 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017397-RA:cdsOSCA017397-RA:cdsOstrinia scapulalisCDSnewscf_1246 5495..5535 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA017397-RA ID=OSCA017397-RA|Name=OSCA017397-RA|organism=Ostrinia scapulalis|type=mRNA|length=603bp
TCCTTCGACTGGAGCATCAAAGAGCAGAGCCTGGTGCTGTCCGCCTTCAC
TTGGGGGTACGTGGTGACGCAGACGCCGGGCGGCGAGCTGGTGGCCAGGC
TCGGGAGAAAGAATGGTGTCATGTCTGCCATTCCTTACATCGCCATAGTC
CTCTTGAGTTTGCCGTTCGGGTACTTTGCCGACTTATCCATCAAGAAGAA
ATGGTGCAGCCTAACTGTTACAAGAAAGATCTGCAACACTTTTGGCTTCT
TTGGCCCTGCGCTGGCGCTGATTGGCCTGTCGTACGCGCCGGCNGGTGAC
GTCACGTCCGCTGTGGCTCTGCTCACCTTAGTGGTGGCTCTCAATGCNGG
ACACTTCACCGGGTTCATGCTGGGCCACATCGACATGGCGCCGAACTTCG
CGGGCACCATGAGTGGCATCACCAATGGNATATCCAACACGGATGCAAAC
GAATGGCGCAAGGTGTTTTACTTATCTTCAGGAATCTATATCGGCTGCAA
TATTTTCTACGTCATCTTTGGAAGCAGCGAGCGACAAGATTGGAATGAGC
CTGAAACCAGTGATGCCGATACTGTGAAGAAAGAAGAAGCAGCAAAGGCG
TAA
back to top

spliced messenger RNA

>OSCA017397-RA ID=OSCA017397-RA|Name=OSCA017397-RA|organism=Ostrinia scapulalis|type=mRNA|length=603bp|location=Sequence derived from alignment at newscf_1246:374..5535+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
TCCTTCGACTGGAGCATCAAAGAGCAGAGCCTGGTGCTGTCCGCCTTCAC
TTGGGGGTACGTGGTGACGCAGACGCCGGGCGGCGAGCTGGTGGCCAGGC
TCGGGAGAAAGAATGGTGTCATGTCTGCCATTCCTTACATCGCCATAGTC
CTCTTGAGTTTGCCGTTCGGGTACTTTGCCGACTTATCCATCAAGAAGAA
ATGGTGCAGCCTAACTGTTACAAGAAAGATCTGCAACACTTTTGGCTTCT
TTGGCCCTGCGCTGGCGCTGATTGGCCTGTCGTACGCGCCGGCRGGTGAC
GTCACGTCCGCTGTGGCTCTGCTCACCTTAGTGGTGGCTCTCAATGCYGG
ACACTTCACCGGGTTCATGCTGGGCCACATCGACATGGCGCCGAACTTCG
CGGGCACCATGAGTGGCATCACCAATGGSATATCCAACACGGATGCAAAC
GAATGGCGCAAGGTGTTTTACTTATCTTCAGGAATCTATATCGGCTGCAA
TATTTTCTACGTCATCTTTGGAAGCAGCGAGCGACAAGATTGGAATGAGC
CTGAAACCAGTGATGCCGATACTGTGAAGAAAGAAGAAGCAGCAAAGGCG
TAA
back to top

protein sequence of OSCA017397-RA

>OSCA017397-PA ID=OSCA017397-PA|Name=OSCA017397-RA|organism=Ostrinia scapulalis|type=polypeptide|length=200bp
SFDWSIKEQSLVLSAFTWGYVVTQTPGGELVARLGRKNGVMSAIPYIAIV
LLSLPFGYFADLSIKKKWCSLTVTRKICNTFGFFGPALALIGLSYAPAGD
VTSAVALLTLVVALNAGHFTGFMLGHIDMAPNFAGTMSGITNGISNTDAN
EWRKVFYLSSGIYIGCNIFYVIFGSSERQDWNEPETSDADTVKKEEAAKA
back to top

mRNA from alignment at newscf_1246:374..5535+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA017397-RA ID=OSCA017397-RA|Name=OSCA017397-RA|organism=Ostrinia scapulalis|type=mRNA|length=5162bp|location=Sequence derived from alignment at newscf_1246:374..5535+ (Ostrinia scapulalis)
TCCTTCGACTGGAGCATCAAAGAGCAGAGCCTGGTGCTGTCCGCCTTCAC TTGGGGGTACGTGGTGACGCAGACGCCGGGCGGCGAGCTGGTGGCCAGGC TCGGGAGAAAGGTCCTCCTCTGCAACGCCTTGATCACNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNAAAGCGGATGACAGGTGACAAACAAAGG TTTAAAACCTAAGAAAAGATTATGCACCACGGACAATAAATATCAATTTA GGGGGCCTATCTTATGAGCAATTAGCCAATAATATTTTGTTTATTTGAAA TTCTGTTTTTAGGATTGTTGGAATGGCCTAATGTTTATGTCTATCAGAGT ATAATTAGAAAGTCACGAAGAGAACAAGGTTGATATTTTATGAGCGCTCC GCAAAGTCAATGGATATCGTGCAAAAATGTATCTTTTTCTGTCCCTAGAT TTTGATATTTTTATATTTCCAGAATGGTGTCATGTCTGCCATTCCTTACA TCGCCATAGTCCTCTTGAGTTTGCCGTTCGGGTACTTTGCCGACTTATCC ATCAAGAAGAAATGGTGCAGCCTAACTGTTACAAGAAAGATCTGCAACAC TTTTGGTATGATTATTGTAGGAGTACAAACACGATTTAAAAAATAAGATG TCTAAGCATGTTCGCATGATTCGAAAGATTCCTAAAAACGCCTTAATTCC TATTTTACCACTTTAATATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATAATAATACTATCATTACG TAATAATGACATAAGATTACTTCAGGCTTCTTTGGCCCTGCGCTGGCGCT GATTGGCCTGTCGTACGCGCCGGCRGGTGACGTCACGTCCGCTGTGGCTC TGCTCACCTTAGTGGTGGCTCTCAATGCYGGACACTTCACCGGGTTCATG GTAACTATACACTGACTATAGAAAAACGCCACATGGAATTAAGCTCCCGT TTTGTATCCTCTTTAATTTTCAAATTAATATAGAAATATACAGGGTCTTG ATTTCAATCCTGCCATATTTATTTAGGTGATCTATTATGAATTATAAAAA CGCATTATCCACAAAAAAAAAATACAAACGAAAGTGGAATTTTTAGAGGA TATTTTCCGTGCGACATCAATTGTACTGTGGCTCGTAACACTGCAATACG TTTACACTGCGGCACCATCGAGCTACGCGGATCGCTCGCTTATCATGTCG GATAGCCTACTGAAAGAAGCCACGTAAAGTAGGTAGTGTAAATAGTTATT TTTCTTTGACTAACTAAAGTTGAAGTTCGTTTAAATTTTTTTTCGAAGTA AATTTTTTTACTGATTCGTGATCAGAATAAGCTACTTAATCAACTCCCTA AATATGGCGAGGTTTGAAATCAACAGCCTGTATAAAATTACGTCGTCGTC GTCGTTATAGAAAGCCTTGAGGGAGGCCTTTGTCCAGCAGTGGACGTCAT TGCGCTGAAACGATATAAAATTACACTATTCTAAAACTTTTTAATCCCTC CTATTTAACCCACTCATGCGTTAATATCGATATTATTTTACAGATTATCT TTTTGATTCGTTCCAGCTGGGCCACATCGACATGGCGCCGAACTTCGCGG GCACCATGAGTGGCATCACCAATGGSATATCCAACGTGTTCTCCATCTTC GCACCCATTGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNTACATAGTGCTGAGAAAAATATCCAAATCCAATACAGAAAATAT ATTTTCTTCTAATTTCTGTTTTCGCCAAATAATTTCATTGTATCTTTTCA GACGGATGCAAACGAATGGCGCAAGGTGTTTTACTTATCTTCAGGAATCT ATATCGGCTGCAATATTTTCTACGTCATCTTTGGAAGCAGCGAGCGACAA GATTGGAATGAGCCTGAAACCAGTGGTATGTACTGTTTTTTTTTTGTATT AAAAAACGAAGCTTAAGCTTAAACCAAACTTATAGAAAACAACCATGTAA TTGGTCGAATATTGGAACGTAACCAAGCACTGGCCATAAAGAATGGATTT AAAAGTTTTCATAATAAAATTGTAAAAAGATGCAGATTAGCGTTATATTT CTGCACGTGCGATCTTTTTTTGCGAGTCCTATAAGTGATAAGAATCACGT CTAGAATTCTAAAGTACCTAACTATCTTGTTATTGAAGTGCATTGAGTGT CAAAAAGTGCAGACGAATGCACTTTTTGACACTCAATGCAAGATCAATCT GAAAGAGCGCATAGTATTATTAGTTTCAGAATTTATTTGCAGTAATATTT ATAGCTTTTTTTACTTAACAGATGCCGATACTGTGAAGAAAGAAGAAGCA GCAAAGGCGTAA
back to top

Coding sequence (CDS) from alignment at newscf_1246:374..5535+

>OSCA017397-RA ID=OSCA017397-RA|Name=OSCA017397-RA|organism=Ostrinia scapulalis|type=CDS|length=603bp|location=Sequence derived from alignment at newscf_1246:374..5535+ (Ostrinia scapulalis)
TCCTTCGACTGGAGCATCAAAGAGCAGAGCCTGGTGCTGTCCGCCTTCAC
TTGGGGGTACGTGGTGACGCAGACGCCGGGCGGCGAGCTGGTGGCCAGGC
TCGGGAGAAAGAATGGTGTCATGTCTGCCATTCCTTACATCGCCATAGTC
CTCTTGAGTTTGCCGTTCGGGTACTTTGCCGACTTATCCATCAAGAAGAA
ATGGTGCAGCCTAACTGTTACAAGAAAGATCTGCAACACTTTTGGCTTCT
TTGGCCCTGCGCTGGCGCTGATTGGCCTGTCGTACGCGCCGGCRGGTGAC
GTCACGTCCGCTGTGGCTCTGCTCACCTTAGTGGTGGCTCTCAATGCYGG
ACACTTCACCGGGTTCATGCTGGGCCACATCGACATGGCGCCGAACTTCG
CGGGCACCATGAGTGGCATCACCAATGGSATATCCAACACGGATGCAAAC
GAATGGCGCAAGGTGTTTTACTTATCTTCAGGAATCTATATCGGCTGCAA
TATTTTCTACGTCATCTTTGGAAGCAGCGAGCGACAAGATTGGAATGAGC
CTGAAACCAGTGATGCCGATACTGTGAAGAAAGAAGAAGCAGCAAAGGCG
TAA
back to top
Synonyms
The feature 'OSCA017397-RA' has the following synonyms
Synonym
maker-newscf_1246-snap-gene-0.4-mRNA-1