OSCA017726-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA017726-RA
Unique NameOSCA017726-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length780
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19904contignewscf_19904:1186..3011 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.10
QI0|0|0|0.8|0.5|0.4|5|0|259
AED0.10
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA017726OSCA017726Ostrinia scapulalisgenenewscf_19904 1186..3011 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017726-RAOSCA017726-PAOstrinia scapulalispolypeptidenewscf_19904 1186..3011 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017726-RA:cdsOSCA017726-RA:cdsOstrinia scapulalisCDSnewscf_19904 1186..1373 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA017726-RA:exon:2582OSCA017726-RA:exon:2582Ostrinia scapulalisexonnewscf_19904 1186..1373 -
OSCA017726-RA:exon:2583OSCA017726-RA:exon:2583Ostrinia scapulalisexonnewscf_19904 1882..2038 -
OSCA017726-RA:exon:2584OSCA017726-RA:exon:2584Ostrinia scapulalisexonnewscf_19904 2382..2692 -
OSCA017726-RA:exon:2585OSCA017726-RA:exon:2585Ostrinia scapulalisexonnewscf_19904 2821..2933 -
OSCA017726-RA:exon:2586OSCA017726-RA:exon:2586Ostrinia scapulalisexonnewscf_19904 3001..3011 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA017726-RA ID=OSCA017726-RA|Name=OSCA017726-RA|organism=Ostrinia scapulalis|type=mRNA|length=780bp
ATGCTAGAAGAACCTTTCCTGCGCCGCTCGCATTCAGTTCTCGAGTGGCG
ACCACGAGCCGGAAGACGTAGTGCGGACAAGCCTCCCATTAGGTGGACCG
ACGATCTGGTGAAGGTCACGGAAGCAATTTACCAATATGATCTGACCCTG
CAACGACTCTTACGTATTTTATTTTACAGAACCCAAAATCTGCCAATATT
CGTGCGCATGATCGACAAGGACACGTATTGGACCTTCGAGAACGGGCTCC
CAACCCTCGTGACCACGCTCCTGCAGATGAACATGAACGGCTACCCGCTG
GTGCTGCCGGACATGATCGGAGGCAACGGGTACAACGAGCCGCCCAGCAA
GGAGCTGTTCATACGGTGGCTGCAGGCGAATACGTTTATGCCTAGCTTGC
AGTTCTCGTATGTGCCTTGGGACTTTGACAATGAAACGATCGCGTTAAGC
AAGAAGTACGTAGACCTGCACGCGCAGTATGCACCGCAGATCATAGCGGC
GTGTGCAAACGCAGTGGCCACGGGCGCGCCCGTCAACCCGCCTGTTTGGT
GGATCGCGCCTGACGACAGCGAGGCTTATGATATCTGGGACCAATACATG
CTCGGCGAGACGATCCTAGTAGCGCCAGTGCTAGAGAAGGGAGCGACGGA
GCGCGACATCTACCTGCCGGCCGGCACNTGGCTGGCGCAGGGCGAGCCCG
GCCGGCGCCACGCGGGCGGCGACTGGCTGCGGCGCTACCCCGCCAAGCTG
CAAGACCTGCCCTACTTTATTAAGGCGTAA
back to top

spliced messenger RNA

>OSCA017726-RA ID=OSCA017726-RA|Name=OSCA017726-RA|organism=Ostrinia scapulalis|type=mRNA|length=780bp|location=Sequence derived from alignment at newscf_19904:1186..3011- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGCTAGAAGAACCTTTCCTGCGCCGCTCGCATTCAGTTCTCGAGTGGCG
ACCACGAGCCGGAAGACGTAGTGCGGACAAGCCTCCCATTAGGTGGACCG
ACGATCTGGTGAAGGTCACGGAAGCAATTTACCAATATGATCTGACCCTG
CAACGACTCTTACGTATTTTATTTTACAGAACCCAAAATCTGCCAATATT
CGTGCGCATGATCGACAAGGACACGTATTGGACCTTCGAGAACGGGCTCC
CAACCCTCGTGACCACGCTCCTGCAGATGAACATGAACGGCTACCCGCTG
GTGCTGCCGGACATGATCGGAGGCAACGGGTACAACGAGCCGCCCAGCAA
GGAGCTGTTCATACGGTGGCTGCAGGCGAATACGTTTATGCCTAGCTTGC
AGTTCTCGTATGTGCCTTGGGACTTTGACAATGAAACGATCGCGTTAAGC
AAGAAGTACGTAGACCTGCACGCGCAGTATGCACCGCAGATCATAGCGGC
GTGTGCAAACGCAGTGGCCACGGGCGCGCCCGTCAACCCGCCTGTTTGGT
GGATCGCGCCTGACGACAGCGAGGCTTATGATATCTGGGACCAATACATG
CTCGGCGAGACGATCCTAGTAGCGCCAGTGCTAGAGAAGGGAGCGACGGA
GCGCGACATCTACCTGCCGGCCGGCACWTGGCTGGCGCAGGGCGAGCCCG
GCCGGCGCCACGCGGGCGGCGACTGGCTGCGGCGCTACCCCGCCAAGCTG
CAAGACCTGCCCTACTTTATTAAGGCGTAA
back to top

protein sequence of OSCA017726-RA

>OSCA017726-PA ID=OSCA017726-PA|Name=OSCA017726-RA|organism=Ostrinia scapulalis|type=polypeptide|length=259bp
MLEEPFLRRSHSVLEWRPRAGRRSADKPPIRWTDDLVKVTEAIYQYDLTL
QRLLRILFYRTQNLPIFVRMIDKDTYWTFENGLPTLVTTLLQMNMNGYPL
VLPDMIGGNGYNEPPSKELFIRWLQANTFMPSLQFSYVPWDFDNETIALS
KKYVDLHAQYAPQIIAACANAVATGAPVNPPVWWIAPDDSEAYDIWDQYM
LGETILVAPVLEKGATERDIYLPAGTWLAQGEPGRRHAGGDWLRRYPAKL
QDLPYFIKA
back to top

mRNA from alignment at newscf_19904:1186..3011-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA017726-RA ID=OSCA017726-RA|Name=OSCA017726-RA|organism=Ostrinia scapulalis|type=mRNA|length=1826bp|location=Sequence derived from alignment at newscf_19904:1186..3011- (Ostrinia scapulalis)
ATGCTAGAAGAGTTCGTTCGTTTCAGCCGAAAGACGTCCACTGCTGCACA AAGGCCTCCCCCAAGGTTTTACACACAGACCTTTCCTGCGCCGCTCGCAT TCAGTTCTCGAGTGGCGACCACGAGCCGGAAGACGTAGTGCGGACAAGCC TCCCATTAGGTGGACCGACGATCTGGTGAAGGTCACGGAAGGTGCTAGAA GAGTTACCAATGCAAAATTGCACAATTTTCTTCAGGACTCCATTTTGATT TGAGAGAAAGTTGATCCATTCAGAATTGAAATTCTGTTCCGCTATTCGGC TATAGTTGTTATCTAACAGCAATTTACCAATATGATCTGACCCTGCAACG ACTCTTACGTATTTTATTTTACAGAACCCAAAATCTGCCAATATTCGTGC GCATGATCGACAAGGACACGTATTGGACCTTCGAGAACGGGCTCCCAACC CTCGTGACCACGCTCCTGCAGATGAACATGAACGGCTACCCGCTGGTGCT GCCGGACATGATCGGAGGCAACGGGTACAACGAGCCGCCCAGCAAGGAGC TGTTCATACGGTGGCTGCAGGCGAATACGTTTATGCCTAGCTTGCAGTTC TCGTATGTGCCTTGGGACTTTGACAATGAAGTAAGTGGACTTTTGATACT AGTGTGACCAAAAGGATGTAATTATTCTAGAGAAAGAACTGCAACTAGAT TGAGAATAAGAGATCTTCTTGCAAACGAGCAGTAAACTTTATCAGGCCGT GGCTGTCATGGAATTATTTCTTGTTCAAAATATTTCTGTATCATAAGTTT CCGATCTTGAGGTTACTAACGAATGGCCAATGATAGCGTGGCGGCATTGG ACTGTCAATTTGAGAGCCAACAATTCCTAGCATGATTAATTTCTTTCTGA TAAGAAAAGATCTACATCATCCAATGAAACGTCCGAGGGTTTTCCAATCT AATGCATTTATGTTCTTCCCCAGACGATCGCGTTAAGCAAGAAGTACGTA GACCTGCACGCGCAGTATGCACCGCAGATCATAGCGGCGTGTGCAAACGC AGTGGCCACGGGCGCGCCCGTCAACCCGCCTGTTTGGTGGATCGCGCCTG ACGACAGCGAGGCTTATGATATCTGGGACCGTGAGTACACCAAGCTTCTG TAGTGGTTCCCTAGAGGCCATTGAAATGACTGACTGGAAGTCTGGCGATA ATCTAGAAATAGAACAACTAGACCGACGGCTCAGTGATTTCCAGATTTTC ACCATTACAAGAGATGACAGTCCACTGCTAGACGTAAGCCATAAAGCTGC TTATTATACAACCACTAGCAAAATTCTTGAGGTTGGCGGTCAAAAGCAAT TAAACCTTGAAGAGTTCCAATCCTTTGCAATTCGCGTGTTCATCACAATT AACATGTACCTACTGTGTGTTGCCGAACTGTCCTAAGATATAGCAAGTCC TGTAATCCTGTTAGCTGTGAATTATCTAGTCTACCCTTTTTAATCCTATA TCATATTTTTAAATTATGACGATGAAATGATGATGATGACATCAGATTTT TTATTAGTCATTGCGGTAGCACGACCCTCTCAGATCTACCAGAGACAAAT GGAGGATATTTTTTTCAAATTGAAACCTTTATTTCTAGAATACATGCTCG GCGAGACGATCCTAGTAGCGCCAGTGCTAGAGAAGGGAGCGACGGAGCGC GACATCTACCTGCCGGCCGGCACWTGGCTGGCGCAGGGCGAGCCCGGCCG GCGCCACGCGGGCGGCGACTGGCTGCGGCGCTACCCCGCCAAGCTGCAAG ACCTGCCCTACTTTATTAAGGCGTAA
back to top

Coding sequence (CDS) from alignment at newscf_19904:1186..3011-

>OSCA017726-RA ID=OSCA017726-RA|Name=OSCA017726-RA|organism=Ostrinia scapulalis|type=CDS|length=780bp|location=Sequence derived from alignment at newscf_19904:1186..3011- (Ostrinia scapulalis)
ATGCTAGAAGAACCTTTCCTGCGCCGCTCGCATTCAGTTCTCGAGTGGCG
ACCACGAGCCGGAAGACGTAGTGCGGACAAGCCTCCCATTAGGTGGACCG
ACGATCTGGTGAAGGTCACGGAAGCAATTTACCAATATGATCTGACCCTG
CAACGACTCTTACGTATTTTATTTTACAGAACCCAAAATCTGCCAATATT
CGTGCGCATGATCGACAAGGACACGTATTGGACCTTCGAGAACGGGCTCC
CAACCCTCGTGACCACGCTCCTGCAGATGAACATGAACGGCTACCCGCTG
GTGCTGCCGGACATGATCGGAGGCAACGGGTACAACGAGCCGCCCAGCAA
GGAGCTGTTCATACGGTGGCTGCAGGCGAATACGTTTATGCCTAGCTTGC
AGTTCTCGTATGTGCCTTGGGACTTTGACAATGAAACGATCGCGTTAAGC
AAGAAGTACGTAGACCTGCACGCGCAGTATGCACCGCAGATCATAGCGGC
GTGTGCAAACGCAGTGGCCACGGGCGCGCCCGTCAACCCGCCTGTTTGGT
GGATCGCGCCTGACGACAGCGAGGCTTATGATATCTGGGACCAATACATG
CTCGGCGAGACGATCCTAGTAGCGCCAGTGCTAGAGAAGGGAGCGACGGA
GCGCGACATCTACCTGCCGGCCGGCACWTGGCTGGCGCAGGGCGAGCCCG
GCCGGCGCCACGCGGGCGGCGACTGGCTGCGGCGCTACCCCGCCAAGCTG
CAAGACCTGCCCTACTTTATTAAGGCGTAA
back to top
Synonyms
The feature 'OSCA017726-RA' has the following synonyms
Synonym
maker-newscf_19904-augustus-gene-0.2-mRNA-1