OSCA018774-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA018774-RA
Unique NameOSCA018774-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length485
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_18642contignewscf_18642:69..3036 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.11
QI53|0|0|0.75|0.66|0.75|4|0|144
AED0.11
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA018774OSCA018774Ostrinia scapulalisgenenewscf_18642 69..3036 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA018774-RAOSCA018774-PAOstrinia scapulalispolypeptidenewscf_18642 69..2983 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA018774-RA:cdsOSCA018774-RA:cdsOstrinia scapulalisCDSnewscf_18642 69..175 -


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA018774-RA:five_prime_utrOSCA018774-RA:five_prime_utrOstrinia scapulalisfive_prime_UTRnewscf_18642 2984..3036 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA018774-RA:exon:3186OSCA018774-RA:exon:3186Ostrinia scapulalisexonnewscf_18642 69..175 -
OSCA018774-RA:exon:3187OSCA018774-RA:exon:3187Ostrinia scapulalisexonnewscf_18642 871..1040 -
OSCA018774-RA:exon:3188OSCA018774-RA:exon:3188Ostrinia scapulalisexonnewscf_18642 2158..2279 -
OSCA018774-RA:exon:3189OSCA018774-RA:exon:3189Ostrinia scapulalisexonnewscf_18642 2951..3036 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA018774-RA ID=OSCA018774-RA|Name=OSCA018774-RA|organism=Ostrinia scapulalis|type=mRNA|length=485bp
GCTATTTGAGCGACCCCGACGAGCTACCAGGGCTGGCGCATTTCTGCGAG
CACATGCTCTTTTTGGGCACTGAGAAGTATCCAGAGGAAAACGAGTACAA
CAAGTTCCTATCAGAGCATGGCGGCTCGTCCAATGCTTCTACATCATCCG
ACCACACCACTTACTACTTCGACGTACTACCCGCACATCTGGCCGGCGCT
TTGGACATTTTCGCCCAGTTCTTTATCGCGCCTCTTTTCACGGAGTCGGC
CACCGGTCGGGAGCTGTCAGCTGTCAACTCTGAACATGAGAAGAACACTT
CTTCTGACACGTGGAGGCTGGACCAGCTGAACAAAAGCACCGCGTTACCT
ACACATCCGTTTCACAAGTTTGGCACTGCTGTCAACTCGGAACATGACAA
GAACGCTTCTTCAGACACGTGGAGGCTGNACCAGTTGAATAAGAGGACAG
CGCTGCCTACACATCCCTTTCACAAGTTTGGCACC
back to top

spliced messenger RNA

>OSCA018774-RA ID=OSCA018774-RA|Name=OSCA018774-RA|organism=Ostrinia scapulalis|type=mRNA|length=485bp|location=Sequence derived from alignment at newscf_18642:69..3036- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
GCTATTTGAGCGACCCCGACGAGCTACCAGGGCTGGCGCATTTCTGCGAG
CACATGCTCTTTTTGGGCACTGAGAAGTATCCAGAGGAAAACGAGTACAA
CAAGTTCCTATCAGAGCATGGCGGCTCGTCCAATGCTTCTACATCATCCG
ACCACACCACTTACTACTTCGACGTACTACCCGCACATCTGGCCGGCGCT
TTGGACATTTTCGCCCAGTTCTTTATCGCGCCTCTTTTCACGGAGTCGGC
CACCGGTCGGGAGCTGTCAGCTGTCAACTCTGAACATGAGAAGAACACTT
CTTCTGACACGTGGAGGCTGGACCAGCTGAACAAAAGCACCGCGTTACCT
ACACATCCGTTTCACAAGTTTGGCACTGCTGTCAACTCGGAACATGACAA
GAACGCTTCTTCAGACACGTGGAGGCTGKACCAGTTGAATAAGAGGACAG
CGCTGCCTACACATCCCTTTCACAAGTTTGGCACC
back to top

protein sequence of OSCA018774-RA

>OSCA018774-PA ID=OSCA018774-PA|Name=OSCA018774-RA|organism=Ostrinia scapulalis|type=polypeptide|length=144bp
MLFLGTEKYPEENEYNKFLSEHGGSSNASTSSDHTTYYFDVLPAHLAGAL
DIFAQFFIAPLFTESATGRELSAVNSEHEKNTSSDTWRLDQLNKSTALPT
HPFHKFGTAVNSEHDKNASSDTWRLXQLNKRTALPTHPFHKFGT
back to top

mRNA from alignment at newscf_18642:69..3036-

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA018774-RA ID=OSCA018774-RA|Name=OSCA018774-RA|organism=Ostrinia scapulalis|type=mRNA|length=2968bp|location=Sequence derived from alignment at newscf_18642:69..3036- (Ostrinia scapulalis)
GCTATTTGAGCGACCCCGACGAGCTACCAGGGCTGGCGCATTTCTGCGAG CACATGCTCTTTTTGGGCACTGAGAAGTATCCAGAGGTTAGTCATCATCA TCATCATTTTAGCCATAGGACGTCCACTGCTGAACATAGGCCTCCCCCAA TGATTTCCATATTGCCCGGTTGGCAGCGGCCTGCATCCAGCGCCTTCCTG CTTTCTTTATGAGCGAGACAGCGCGGCGACCTGGCTGCCTAATGCGCGGG CGCATTTAGCCTTACGATTGAGCTATTGTCGGCCATTTGGTGTAGTGAAT CGTAAATGACTACTAAGCCAGAAGTAGCGGGTTTGATTTCCGCACAGAAC AAACATATCGATTTCACAGTGTATAAAACCCCCAAGCGGGGTTACTCCGA AAAACGTCATCCAAAGTTTCGTATGTTGCCATCTCTTTCGCACAAAACGA GACGCCAGCATGAGCGACGGTGACATATAGACCCGAAACTACGTACTAGC GTTCCCAAGTAGCCCCCCAAGGCGCAGAATCGTCACGAAATCTGAATTTT CGCTGACCACTTAACCCCCCTTAAAAGGTTTGGTTACGGAGCATTTAATT TTAAACTTTAGCGTTGCGCAATTTAATTTTAACACGAAATGTCAGGTAAA TACAGGTAATACTGAAATATTACCTGTATTTGCCTGATGTTTCGACAGGT TGGTCAAAGGCTGACTGTGTGTCAGTTAAAACCTAACAATTTTGTTGTTA TTTGCAGGAAAACGAGTACAACAAGTTCCTATCAGAGCATGGCGGCTCGT CCAATGCTTCTACATCATCCGACCACACCACTTACTACTTCGACGTACTA CCCGCACATCTGGCCGGCGCTTTGGACATGTGAGTAGTGTAGAATAAAGT CAAAGTCAAAGTCAAAATTTCTTTATTTGTTTAGACTAATAAATAGTTCT TACAAATCGTCATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCACAGACCACCGA GTTTTAGTTGGCCGATAGTTTTCGGGTGTTAATCAGTACGGAGATGTATG AAAGTGCGCACATTACACCGATTTGGTATCGGCCGATTCTTCATACAAAT TAAAAGCGGGCCCAACTATCAGCCAACTAAAAAATCGGTGGCCTAGGCTA AATGGTCTATGATCAGTTATTGCAGGAAACCCACTGTAGAAAAGCCAGTT AATCTGCCATATGASCTGATGCTGATGATTATCTTTACACCCGCAGTTTC GCCCAGTTCTTTATCGCGCCTCTTTTCACGGAGTCGGCCACCGGTCGGGA GCTGTCAGCTGTCAACTCTGAACATGAGAAGAACACTTCTTCTGACACGT GGAGGCTGGACCAGCTGAACAAAAGCACCGCGTTACCTACACATCCGTTT CACAAGTTTGGCACTGGTGAGTAGGATGCCTCCCCTCCCGGATTGGACTG CCCCCCATAGGATCAGACTCCCCCTCCCTTCGGATAAGAAAAACACATCC CCAAGATTAGACCCGCCTGGTCCAGATTACCCCCCTTAGATTATACTGCC TCCCTCGCACCGGAAGCCCCCCATGATAAGACTTCCTTCGGATCAGGCAA CATCTTTCCCAGGATACCCCCCTGAGTCTGAATCAAACAGTCCCCTTTAG ATCAGTGACCCTCTATTCCAGTTCCCTGTACGGAACTACTAGTACTGGCA CGAAAAACTTTCAAATTCGAATCGTTTGCGTATTCGAATCGCCATCAAAA GATTTAGTACGAAAATTACAACTGCGTCCTTGTGGACGTGTCGTAAACTG AACCTAGTATGAGAAATGGTTGCACGAAACTTATTTTGAGAATCAAAATT GTCACTTTATCGTTTAATTCGAAGTATCGAGTCTTGTTAAATACGCAAAC GATTCGAAGACGAAAGTTGTTCATGCTACAGCCTCCCTGGATCTCCACTC TTCCCAATTAACCACTCCCTCGGACTAGAGTTCCCTCCTCTGATCAGACA TCAGATCAATCCAGGGGAAGAGGGTGCAGGACTCTAGGGGAGGCCCTAGA GTCCTGCACCCTCTTCCCCTGGATTAACCCCCTCTACCTATTGCCTGTCG GGAACTGTCAGCTGTCAACTCGGAACATGACAAGAACGCTTCTTCAGACA CGTGGAGGCTGKACCAGTTGAATAAGAGGACAGCGCTGCCTACACATCCC TTTCACAAGTTTGGCACC
back to top

Coding sequence (CDS) from alignment at newscf_18642:69..3036-

>OSCA018774-RA ID=OSCA018774-RA|Name=OSCA018774-RA|organism=Ostrinia scapulalis|type=CDS|length=432bp|location=Sequence derived from alignment at newscf_18642:69..3036- (Ostrinia scapulalis)
ATGCTCTTTTTGGGCACTGAGAAGTATCCAGAGGAAAACGAGTACAACAA
GTTCCTATCAGAGCATGGCGGCTCGTCCAATGCTTCTACATCATCCGACC
ACACCACTTACTACTTCGACGTACTACCCGCACATCTGGCCGGCGCTTTG
GACATTTTCGCCCAGTTCTTTATCGCGCCTCTTTTCACGGAGTCGGCCAC
CGGTCGGGAGCTGTCAGCTGTCAACTCTGAACATGAGAAGAACACTTCTT
CTGACACGTGGAGGCTGGACCAGCTGAACAAAAGCACCGCGTTACCTACA
CATCCGTTTCACAAGTTTGGCACTGCTGTCAACTCGGAACATGACAAGAA
CGCTTCTTCAGACACGTGGAGGCTGKACCAGTTGAATAAGAGGACAGCGC
TGCCTACACATCCCTTTCACAAGTTTGGCACC
back to top
Synonyms
The feature 'OSCA018774-RA' has the following synonyms
Synonym
maker-newscf_18642-snap-gene-0.4-mRNA-1