OSCA019134-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA019134-RA
Unique NameOSCA019134-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length834
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25825contignewscf_25825:408..1853 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.23
QI0|0|0|0.75|0.66|0.75|4|0|278
AED0.16
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA019134OSCA019134Ostrinia scapulalisgenenewscf_25825 408..1853 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA019134-RAOSCA019134-PAOstrinia scapulalispolypeptidenewscf_25825 408..1853 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA019134-RA:exon:2332OSCA019134-RA:exon:2332Ostrinia scapulalisexonnewscf_25825 408..523 +
OSCA019134-RA:exon:2333OSCA019134-RA:exon:2333Ostrinia scapulalisexonnewscf_25825 796..1042 +
OSCA019134-RA:exon:2334OSCA019134-RA:exon:2334Ostrinia scapulalisexonnewscf_25825 1060..1395 +
OSCA019134-RA:exon:2335OSCA019134-RA:exon:2335Ostrinia scapulalisexonnewscf_25825 1719..1853 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA019134-RA:cdsOSCA019134-RA:cdsOstrinia scapulalisCDSnewscf_25825 1719..1853 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA019134-RA ID=OSCA019134-RA|Name=OSCA019134-RA|organism=Ostrinia scapulalis|type=mRNA|length=834bp
GTGACAGGAGGAAGGACATGGCCATTGATAAATTGCCTATGCTTCTTCAC
TGCCTTCTTCTCAACGTTTCTTGACAACGTCACCACGGTTCTTCTCATGA
CACCAGTCACTATAAGGTTATGCGAGGTGATGCAGCTGAACCCTGTGCCG
GTTCTGATGTCGATGGTGATCTTCAGCAACGTGGGCGGCGCAGCCACGCC
GGTTGGCGACCCGCCCAACGTCATCATAGCCAGCCACCCCTCCATGCTGG
AGCAAGCAAGTCTTCTTCTTCTGCCTCCCCTTCGTTCGTTCGTTCGTTTC
AGCCGAAAGACGTCCACTGCTGGACAAAGGCCTCCCCCAAGGATTTCCAC
GAAGACTGATGCTGCACCTCCCGCGACCTTCAACAGATCGTCGGTCCACC
TAGGGGGAGGCCTGCCCACGCTACGTCTTCCGGCTCGTGGTAGCCACTCA
AGAACTCTCCTGCCCCAGCGGCCATCAGCTCTACGAGCTATGTGCCCCGC
CCACTGCCACTTTATTTTAGCGAATTTGCGGGCTATGTCAGTCACTCTGG
TTCTCCTACGAATCTCCTCCTGCCTCCCCTTATCAACAAGTTACGCGGTG
TCCGCTTTAATTCTTTTTAATGCACCCGGAAAAGGCTACACCGTATCGCC
TTTCGTCGCGCTATCGCCTATCAACCGCGAGACGTTTACGTTCCGTCCGA
ACATAAACTTCACGACGTTCACGCTACACATGGGCGTGGGAATCCTCCTG
GTGTGCGTGCAGACTTACTTCCAGCTGAGGTTCATGTTCCGGGATATGAA
CAAGCTGAGGCACAGTGTCCCTAGGGATATATTA
back to top

spliced messenger RNA

>OSCA019134-RA ID=OSCA019134-RA|Name=OSCA019134-RA|organism=Ostrinia scapulalis|type=mRNA|length=834bp|location=Sequence derived from alignment at newscf_25825:408..1853+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
GTGACAGGAGGAAGGACATGGCCATTGATAAATTGCCTATGCTTCTTCAC
TGCCTTCTTCTCAACGTTTCTTGACAACGTCACCACGGTTCTTCTCATGA
CACCAGTCACTATAAGGTTATGCGAGGTGATGCAGCTGAACCCTGTGCCG
GTTCTGATGTCGATGGTGATCTTCAGCAACGTGGGCGGCGCAGCCACGCC
GGTTGGCGACCCGCCCAACGTCATCATAGCCAGCCACCCCTCCATGCTGG
AGCAAGCAAGTCTTCTTCTTCTGCCTCCCCTTCGTTCGTTCGTTCGTTTC
AGCCGAAAGACGTCCACTGCTGGACAAAGGCCTCCCCCAAGGATTTCCAC
GAAGACTGATGCTGCACCTCCCGCGACCTTCAACAGATCGTCGGTCCACC
TAGGGGGAGGCCTGCCCACGCTACGTCTTCCGGCTCGTGGTAGCCACTCA
AGAACTCTCCTGCCCCAGCGGCCATCAGCTCTACGAGCTATGTGCCCCGC
CCACTGCCACTTTATTTTAGCGAATTTGCGGGCTATGTCAGTCACTCTGG
TTCTCCTACGAATCTCCTCCTGCCTCCCCTTATCAACAAGTTACGCGGTG
TCCGCTTTAATTCTTTTTAATGCACCCGGAAAAGGCTACACCGTATCGCC
TTTCGTCGCGCTATCGCCTATCAACCGCGAGACGTTTACGTTCCGTCCGA
ACATAAACTTCACGACGTTCACGCTACACATGGGCGTGGGAATCCTCCTG
GTGTGCGTGCAGACTTACTTCCAGCTGAGGTTCATGTTCCGGGATATGAA
CAAGCTGAGGCACAGTGTCCCTAGGGATATATTA
back to top

protein sequence of OSCA019134-RA

>OSCA019134-PA ID=OSCA019134-PA|Name=OSCA019134-RA|organism=Ostrinia scapulalis|type=polypeptide|length=278bp
VTGGRTWPLINCLCFFTAFFSTFLDNVTTVLLMTPVTIRLCEVMQLNPVP
VLMSMVIFSNVGGAATPVGDPPNVIIASHPSMLEQASLLLLPPLRSFVRF
SRKTSTAGQRPPPRISTKTDAAPPATFNRSSVHLGGGLPTLRLPARGSHS
RTLLPQRPSALRAMCPAHCHFILANLRAMSVTLVLLRISSCLPLSTSYAV
SALILFNAPGKGYTVSPFVALSPINRETFTFRPNINFTTFTLHMGVGILL
VCVQTYFQLRFMFRDMNKLRHSVPRDIL
back to top

mRNA from alignment at newscf_25825:408..1853+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA019134-RA ID=OSCA019134-RA|Name=OSCA019134-RA|organism=Ostrinia scapulalis|type=mRNA|length=1446bp|location=Sequence derived from alignment at newscf_25825:408..1853+ (Ostrinia scapulalis)
GTGACAGGAGGAAGGACATGGCCATTGATAAATTGCCTATGCTTCTTCAC TGCCTTCTTCTCAACGTTTCTTGACAACGTCACCACGGTTCTTCTCATGA CACCAGTCACTATAAGGTAAAAAGAATCAGCAACGGGACTATTCCCACCT CTCGTTCCCACCGCTGCAACTCCAGTAAAAACCCAACCAGTGAAAGTCAA GTTTGTCCGGGGGAAAGTTAAACTGTCATTGGACCCGCAACGAAATTAAT AAGAATAACATAGGAGTTCGAAATTAAATTAAATTAAAAATTGTTTATTT CAATAAAGTTACCGGGGTCTCCCAGAAAGTAATCGTAAGATCAATTCTAA GAATTAATTCTCAAGATTCTAAGAATCAAACGTTGCAGGTTATGCGAGGT GATGCAGCTGAACCCTGTGCCGGTTCTGATGTCGATGGTGATCTTCAGCA ACGTGGGCGGCGCAGCCACGCCGGTTGGCGACCCGCCCAACGTCATCATA GCCAGCCACCCCTCCATGCTGGAGCAAGCAAGTCTTCTTCTTCTGCCTCC CCTTCGTTCGTTCGTTCGTTTCAGCCGAAAGACGTCCACTGCTGGACAAA GGCCTCCCCCAAGGATTTCCACGAAGACTGATGCTGTACCGCTCGCATCC AGGCACCTCCCGCGACCTTCAACAGATCGTCGGTCCACCTAGGGGGAGGC CTGCCCACGCTACGTCTTCCGGCTCGTGGTAGCCACTCAAGAACTCTCCT GCCCCAGCGGCCATCAGCTCTACGAGCTATGTGCCCCGCCCACTGCCACT TTATTTTAGCGAATTTGCGGGCTATGTCAGTCACTCTGGTTCTCCTACGA ATCTCCTCCTGCCTCCCCTTATCAACAAGTTACGCGGTGTCCGCTTTAAT TCTTTTTAATGCACCCGGAAAAGGCTACACCGTATCGCCTTTCGTCGCGC TATCGCCTATCAACCGCGAGACGTTTACGTTCCGTCCGGTACAGATAAGT CGTGTGCGTTTGCAGTACAAAGAAATACAATCGCAAACAATGCTGACCCC ATCCTACGGTTACGATCCCTTTCCTGTTTGATAAGTGTGCTTAGTCCTTT ATAATATTAGAAAATAATGGAAATGGAAATAATGGAAAGTCCGGTCGTCG AGCAGATAATAATTTCGTAGAATGTGATTTTCGCACATTCACTGTAAGAC GGGCGGCCGCAGTGAGTGTGCGTGCGCGTTGGGGTCATTGTACGAAATTC CATCTGCTCGGCGACCGGACTTTAGTTGAGACAAAATATTTACTGTCTGG TTTTCTTACAGAACATAAACTTCACGACGTTCACGCTACACATGGGCGTG GGAATCCTCCTGGTGTGCGTGCAGACTTACTTCCAGCTGAGGTTCATGTT CCGGGATATGAACAAGCTGAGGCACAGTGTCCCTAGGGATATATTA
back to top

Coding sequence (CDS) from alignment at newscf_25825:408..1853+

>OSCA019134-RA ID=OSCA019134-RA|Name=OSCA019134-RA|organism=Ostrinia scapulalis|type=CDS|length=834bp|location=Sequence derived from alignment at newscf_25825:408..1853+ (Ostrinia scapulalis)
GTGACAGGAGGAAGGACATGGCCATTGATAAATTGCCTATGCTTCTTCAC
TGCCTTCTTCTCAACGTTTCTTGACAACGTCACCACGGTTCTTCTCATGA
CACCAGTCACTATAAGGTTATGCGAGGTGATGCAGCTGAACCCTGTGCCG
GTTCTGATGTCGATGGTGATCTTCAGCAACGTGGGCGGCGCAGCCACGCC
GGTTGGCGACCCGCCCAACGTCATCATAGCCAGCCACCCCTCCATGCTGG
AGCAAGCAAGTCTTCTTCTTCTGCCTCCCCTTCGTTCGTTCGTTCGTTTC
AGCCGAAAGACGTCCACTGCTGGACAAAGGCCTCCCCCAAGGATTTCCAC
GAAGACTGATGCTGCACCTCCCGCGACCTTCAACAGATCGTCGGTCCACC
TAGGGGGAGGCCTGCCCACGCTACGTCTTCCGGCTCGTGGTAGCCACTCA
AGAACTCTCCTGCCCCAGCGGCCATCAGCTCTACGAGCTATGTGCCCCGC
CCACTGCCACTTTATTTTAGCGAATTTGCGGGCTATGTCAGTCACTCTGG
TTCTCCTACGAATCTCCTCCTGCCTCCCCTTATCAACAAGTTACGCGGTG
TCCGCTTTAATTCTTTTTAATGCACCCGGAAAAGGCTACACCGTATCGCC
TTTCGTCGCGCTATCGCCTATCAACCGCGAGACGTTTACGTTCCGTCCGA
ACATAAACTTCACGACGTTCACGCTACACATGGGCGTGGGAATCCTCCTG
GTGTGCGTGCAGACTTACTTCCAGCTGAGGTTCATGTTCCGGGATATGAA
CAAGCTGAGGCACAGTGTCCCTAGGGATATATTA
back to top
Synonyms
The feature 'OSCA019134-RA' has the following synonyms
Synonym
maker-newscf_25825-snap-gene-0.3-mRNA-1