OSCA019674-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA019674-RA
Unique NameOSCA019674-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length375
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25822contignewscf_25822:303..1408 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.51
QI0|0|0|0.5|0|0.5|2|0|124
AED0.46
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA019674OSCA019674Ostrinia scapulalisgenenewscf_25822 303..1408 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA019674-RAOSCA019674-PAOstrinia scapulalispolypeptidenewscf_25822 303..1408 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA019674-RA:exon:2675OSCA019674-RA:exon:2675Ostrinia scapulalisexonnewscf_25822 303..359 +
OSCA019674-RA:exon:2676OSCA019674-RA:exon:2676Ostrinia scapulalisexonnewscf_25822 1091..1408 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA019674-RA:cdsOSCA019674-RA:cdsOstrinia scapulalisCDSnewscf_25822 1091..1408 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA019674-RA ID=OSCA019674-RA|Name=OSCA019674-RA|organism=Ostrinia scapulalis|type=mRNA|length=375bp
ATGTGTCGAGGTGTAGATTGGCCGGAGGATAAGTTTCACGTCTTAAATGA
TAATATGCCGAAAGACCTCCACTGGTGGACAAGTCCTCCCCCAAGGATTT
CCACAGACTGGTTCTGCGCCGCTCGCATCCAGGCACCTCCCGCGACCTTC
ACGAAATCGTCGGTTCACCTAGTGGGAGACCTGCCCACGCTACGTCTTCC
GGCTCGTGGTCGCCACTCAAGATCTTTCCTGCCCCAGCGGCCATCAGCTC
TACGAGCTATGTGCCCCGCCCACTGCTATTTGATTTTAGGGATTCTGCAG
GTTATGTCAGTCACTTTGGTCCTCCTGTGTCTTGCGTCCTCTCTTAGCGT
AGTCGGAATCAATCTTCTACTTTGA
back to top

spliced messenger RNA

>OSCA019674-RA ID=OSCA019674-RA|Name=OSCA019674-RA|organism=Ostrinia scapulalis|type=mRNA|length=375bp|location=Sequence derived from alignment at newscf_25822:303..1408+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGTGTCGAGGTGTAGATTGGCCGGAGGATAAGTTTCACGTCTTAAATGA
TAATATGCCGAAAGACCTCCACTGGTGGACAAGTCCTCCCCCAAGGATTT
CCACAGACTGGTTCTGCGCCGCTCGCATCCAGGCACCTCCCGCGACCTTC
ACGAAATCGTCGGTTCACCTAGTGGGAGACCTGCCCACGCTACGTCTTCC
GGCTCGTGGTCGCCACTCAAGATCTTTCCTGCCCCAGCGGCCATCAGCTC
TACGAGCTATGTGCCCCGCCCACTGCTATTTGATTTTAGGGATTCTGCAG
GTTATGTCAGTCACTTTGGTCCTCCTGTGTCTTGCGTCCTCTCTTAGCGT
AGTCGGAATCAATCTTCTACTTTGA
back to top

protein sequence of OSCA019674-RA

>OSCA019674-PA ID=OSCA019674-PA|Name=OSCA019674-RA|organism=Ostrinia scapulalis|type=polypeptide|length=124bp
MCRGVDWPEDKFHVLNDNMPKDLHWWTSPPPRISTDWFCAARIQAPPATF
TKSSVHLVGDLPTLRLPARGRHSRSFLPQRPSALRAMCPAHCYLILGILQ
VMSVTLVLLCLASSLSVVGINLLL
back to top

mRNA from alignment at newscf_25822:303..1408+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA019674-RA ID=OSCA019674-RA|Name=OSCA019674-RA|organism=Ostrinia scapulalis|type=mRNA|length=1106bp|location=Sequence derived from alignment at newscf_25822:303..1408+ (Ostrinia scapulalis)
ATGTGTCGAGGTGTAGATTGGCCGGAGGATAAGTTTCACGTCTTAAATGA TAATATGGTGAGACTTCGGGGCTTACTTACATGCGCCACTTGATCAGCCA AGCATTAGTGGCATTTAGCTGGCTTTGCAAATAGTCTATCTAGTTGCTTT AAGATCACAGTTACATTTGAGAAAGGCCGCAGCTTTCTGGTGTCTGGGCT ACTTTACTAGTAAATGTTGTAAGTACAGAGTCCTGGGGTACTCCAGCTCT GCAGCTAAAAAGAGAAGATTTTGGCACGGAGTTTCATTTAAAACTGTCTG TCACTACTGAGATAAGAAATTCATCATTCAGTAGAAGTGTGCTGGAAGGT ACTTTTTAATTTCATATACTACCTAGTCCTTTATGCTAAACCCAGCTGAA GCCGCAGCGAAAGCAGCCGTACAGGATCCTTTCTTTTTCAAACATTGTAC TGATTTCTGCCAAATTTTATAGTCAGGTATACTATATTTCTATATTACAT TGGTCATACTTAGGCAAGGGAATAAACGAGCAATAATGATCCTTTCCCAT AATTTTAATAATACAATGTCAGATTAATTGAGCGATAGGAGGAGAATTCG TTAGGCGACTTGCCAGCCTTATGGATCATTTCCAAAGTTAAGAGACTTGC GAGATTCTCAGACAGTGTGTCATTGTCAAGATCATAGACATCATGGTGAT CAGATTAAATGCAGGTGCTTTACGAGGGTCCATTTTGGCTATTTCTTTAG CTCAGCCATCTCTCTTAGCGTTTGTTCGTTCGTTTCAGCCGAAAGACCTC CACTGGTGGACAAGTCCTCCCCCAAGGATTTCCACAGACTGGTTCTGCGC CGCTCGCATCCAGGCACCTCCCGCGACCTTCACGAAATCGTCGGTTCACC TAGTGGGAGACCTGCCCACGCTACGTCTTCCGGCTCGTGGTCGCCACTCA AGATCTTTCCTGCCCCAGCGGCCATCAGCTCTACGAGCTATGTGCCCCGC CCACTGCTATTTGATTTTAGGGATTCTGCAGGTTATGTCAGTCACTTTGG TCCTCCTGTGTCTTGCGTCCTCTCTTAGCGTAGTCGGAATCAATCTTCTA CTTTGA
back to top

Coding sequence (CDS) from alignment at newscf_25822:303..1408+

>OSCA019674-RA ID=OSCA019674-RA|Name=OSCA019674-RA|organism=Ostrinia scapulalis|type=CDS|length=375bp|location=Sequence derived from alignment at newscf_25822:303..1408+ (Ostrinia scapulalis)
ATGTGTCGAGGTGTAGATTGGCCGGAGGATAAGTTTCACGTCTTAAATGA
TAATATGCCGAAAGACCTCCACTGGTGGACAAGTCCTCCCCCAAGGATTT
CCACAGACTGGTTCTGCGCCGCTCGCATCCAGGCACCTCCCGCGACCTTC
ACGAAATCGTCGGTTCACCTAGTGGGAGACCTGCCCACGCTACGTCTTCC
GGCTCGTGGTCGCCACTCAAGATCTTTCCTGCCCCAGCGGCCATCAGCTC
TACGAGCTATGTGCCCCGCCCACTGCTATTTGATTTTAGGGATTCTGCAG
GTTATGTCAGTCACTTTGGTCCTCCTGTGTCTTGCGTCCTCTCTTAGCGT
AGTCGGAATCAATCTTCTACTTTGA
back to top
Synonyms
The feature 'OSCA019674-RA' has the following synonyms
Synonym
maker-newscf_25822-snap-gene-0.4-mRNA-1