OSCA020326-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA020326-RA
Unique NameOSCA020326-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length306
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19909contignewscf_19909:3..2373 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.26
QI0|0|0|0.66|1|1|3|0|102
AED0.26
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA020326OSCA020326Ostrinia scapulalisgenenewscf_19909 3..2373 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020326-RAOSCA020326-PAOstrinia scapulalispolypeptidenewscf_19909 3..2373 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020326-RA:cdsOSCA020326-RA:cdsOstrinia scapulalisCDSnewscf_19909 3..131 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020326-RA:exon:2377OSCA020326-RA:exon:2377Ostrinia scapulalisexonnewscf_19909 3..131 -
OSCA020326-RA:exon:2378OSCA020326-RA:exon:2378Ostrinia scapulalisexonnewscf_19909 2173..2301 -
OSCA020326-RA:exon:2379OSCA020326-RA:exon:2379Ostrinia scapulalisexonnewscf_19909 2326..2373 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA020326-RA ID=OSCA020326-RA|Name=OSCA020326-RA|organism=Ostrinia scapulalis|type=mRNA|length=306bp
ATGTCAATGTGCCTCCCCGTGCCGCTGACTGAGTTAAGTGCTAGCCCTCT
GGATACAGTGTACGATGTGATGCTGAACATCAGCCTTCTCATCGCGTTGC
TGGGCGGAGTGGTTTTCGTGGTCAGCTTTGCCGGCTGCGTGGGAGCGCTC
CGGGAGAACACTTGCCTGCTTAAATTCCTATCGCGCGGTTTCGTGTTCCC
GCGCTCGCTGCATGGTCTACTGGAGCTGAGCTTCACGGAGCGGGTCGTGC
ACGCTTATAGAGATGATCCGGACTTGCAGAACTTTATAGACTTCGCCCAG
AGCGAT
back to top

spliced messenger RNA

>OSCA020326-RA ID=OSCA020326-RA|Name=OSCA020326-RA|organism=Ostrinia scapulalis|type=mRNA|length=306bp|location=Sequence derived from alignment at newscf_19909:3..2373- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGTCAATGTGCCTCCCCGTGCCGCTGACTGAGTTAAGTGCTAGCCCTCT
GGATACAGTGTACGATGTGATGCTGAACATCAGCCTTCTCATCGCGTTGC
TGGGCGGAGTGGTTTTCGTGGTCAGCTTTGCCGGCTGCGTGGGAGCGCTC
CGGGAGAACACTTGCCTGCTTAAATTCCTATCGCGCGGTTTCGTGTTCCC
GCGCTCGCTGCATGGTCTACTGGAGCTGAGCTTCACGGAGCGGGTCGTGC
ACGCTTATAGAGATGATCCGGACTTGCAGAACTTTATAGACTTCGCCCAG
AGCGAT
back to top

protein sequence of OSCA020326-RA

>OSCA020326-PA ID=OSCA020326-PA|Name=OSCA020326-RA|organism=Ostrinia scapulalis|type=polypeptide|length=102bp
MSMCLPVPLTELSASPLDTVYDVMLNISLLIALLGGVVFVVSFAGCVGAL
RENTCLLKFLSRGFVFPRSLHGLLELSFTERVVHAYRDDPDLQNFIDFAQ
SD
back to top

mRNA from alignment at newscf_19909:3..2373-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA020326-RA ID=OSCA020326-RA|Name=OSCA020326-RA|organism=Ostrinia scapulalis|type=mRNA|length=2371bp|location=Sequence derived from alignment at newscf_19909:3..2373- (Ostrinia scapulalis)
ATGTCAATGTGCCTCCCCGTGCCGCTGACTGAGTTAAGTGCTAGCCCTGT AAGTATGTTTGTACGTTCACAGCTGGATACAGTGTACGATGTGATGCTGA ACATCAGCCTTCTCATCGCGTTGCTGGGCGGAGTGGTTTTCGTGGTCAGC TTTGCCGGCTGCGTGGGAGCGCTCCGGGAGAACACTTGCCTGCTTAAATT CGTGAGTTTACATCCTTTTGACAGGTTTACCCATGATTATTATGGTCTAA TATGATTACTGAGGACGCCGAGAGACCGGACTGGATGAAAATACAGGGGA GTCCCCGAAAAAACTGGACGAAAGTAACGCGAGAGTTCTCGCAAGAAATA GGACGTGAGTCTGCGTGGAGCTTGAATGACAGCAAGGTTCTCGAATGTAC GCCACGTGCCCGCAGCTAGGTGTAGCGTGGATTAGCTTTTTTTTTATGCA CAACGAGGAAGSTCTTGGCCTGTATCTCACCTGATGGTAAGTGANNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNTTCACGGAGCGGGTCGTGCACGCTTATAGAGATGATCCGGACTTGCA GAACTTTATAGACTTCGCCCAGAGCGATGTGAGTACCCAGTTTTGCAGCC TTTTAAAGGGTACTTAAGTTTCTTAATCTGGAGCGGTATCATCATCATTA CAGCCACAGGACGTCCACTGCTGAACATAGACCAAAAATTTCCACATGGC CCGGTTGGTAGCGGCCTGCATCCAGCGCCTTCTTGCTACCTTTGAGGGAC GCTGCAGCCTCCACTCCAGAACCTTGCTGCCTTATCATCCGTCAGTTCTG CGTACTATTGCCACTTCAGCTTGCTAATCCGTCGCTCTGTGTCAGCGACT TTAGCGATAAAGCGCTTTAAATCGCTATAAAGCCGCTGCCAGCTATCGCG CGGTTTCGTGTTCCCGCGCTCGCTGCATGGTCTACTGGAGCTGAGCTTCA CGGAGCGGGTCGTGCACGCTTATAGAGATGATCCGGACTTGCAGAACTTT ATAGACTTCGCCCAGAGCGAT
back to top

Coding sequence (CDS) from alignment at newscf_19909:3..2373-

>OSCA020326-RA ID=OSCA020326-RA|Name=OSCA020326-RA|organism=Ostrinia scapulalis|type=CDS|length=306bp|location=Sequence derived from alignment at newscf_19909:3..2373- (Ostrinia scapulalis)
ATGTCAATGTGCCTCCCCGTGCCGCTGACTGAGTTAAGTGCTAGCCCTCT
GGATACAGTGTACGATGTGATGCTGAACATCAGCCTTCTCATCGCGTTGC
TGGGCGGAGTGGTTTTCGTGGTCAGCTTTGCCGGCTGCGTGGGAGCGCTC
CGGGAGAACACTTGCCTGCTTAAATTCCTATCGCGCGGTTTCGTGTTCCC
GCGCTCGCTGCATGGTCTACTGGAGCTGAGCTTCACGGAGCGGGTCGTGC
ACGCTTATAGAGATGATCCGGACTTGCAGAACTTTATAGACTTCGCCCAG
AGCGAT
back to top
Synonyms
The feature 'OSCA020326-RA' has the following synonyms
Synonym
snap-newscf_19909-processed-gene-0.2-mRNA-1