OSCA020362-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA020362-RA
Unique NameOSCA020362-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length297
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19953contignewscf_19953:13..3091 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.19
QI0|0|0|0.66|1|1|3|0|99
AED0.19
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA020362OSCA020362Ostrinia scapulalisgenenewscf_19953 13..3091 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020362-RAOSCA020362-PAOstrinia scapulalispolypeptidenewscf_19953 13..3091 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020362-RA:exon:2706OSCA020362-RA:exon:2706Ostrinia scapulalisexonnewscf_19953 13..47 +
OSCA020362-RA:exon:2707OSCA020362-RA:exon:2707Ostrinia scapulalisexonnewscf_19953 466..576 +
OSCA020362-RA:exon:2708OSCA020362-RA:exon:2708Ostrinia scapulalisexonnewscf_19953 2941..3091 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020362-RA:cdsOSCA020362-RA:cdsOstrinia scapulalisCDSnewscf_19953 2941..3091 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA020362-RA ID=OSCA020362-RA|Name=OSCA020362-RA|organism=Ostrinia scapulalis|type=mRNA|length=297bp
ATGGGTGACAAACTTACTAAATTAGATATAGTGAGGTATAGTAGACAGAT
CCTACTACCAGATATTGGTGTAACGGGGCAAGAAAAGCTGTGCGCTGCTA
AGGTTTTGGTCGTCGGTGCAGGAGGATTAGGCTGCCCTGCTGCGATCATC
AACTCACATATCAAGGTACAACCGTACAATGTACAGTTGGATTCGACGAA
CGCTCTGGATATCGCGTCGCGATACGACGTCGTGCTTGACTGTACTGACA
ACGTGCCTACAAGATATTTGTTGAACGACGCTTGTGCGATTACCAAG
back to top

spliced messenger RNA

>OSCA020362-RA ID=OSCA020362-RA|Name=OSCA020362-RA|organism=Ostrinia scapulalis|type=mRNA|length=297bp|location=Sequence derived from alignment at newscf_19953:13..3091+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGGTGACAAACTTACTAAATTAGATATAGTGAGGTATAGTAGACAGAT
CCTACTACCAGATATTGGTGTAACGGGGCAAGAAAAGCTGTGCGCTGCTA
AGGTTTTGGTCGTCGGTGCAGGAGGATTAGGCTGCCCTGCTGCGATCATC
AACTCACATATCAAGGTACAACCGTACAATGTACAGTTGGATTCGACGAA
CGCTCTGGATATCGCGTCGCGATACGACGTCGTGCTTGACTGTACTGACA
ACGTGCCTACAAGATATTTGTTGAACGACGCTTGTGCGATTACCAAG
back to top

protein sequence of OSCA020362-RA

>OSCA020362-PA ID=OSCA020362-PA|Name=OSCA020362-RA|organism=Ostrinia scapulalis|type=polypeptide|length=99bp
MGDKLTKLDIVRYSRQILLPDIGVTGQEKLCAAKVLVVGAGGLGCPAAII
NSHIKVQPYNVQLDSTNALDIASRYDVVLDCTDNVPTRYLLNDACAITK
back to top

mRNA from alignment at newscf_19953:13..3091+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA020362-RA ID=OSCA020362-RA|Name=OSCA020362-RA|organism=Ostrinia scapulalis|type=mRNA|length=3079bp|location=Sequence derived from alignment at newscf_19953:13..3091+ (Ostrinia scapulalis)
ATGGGTGACAAACTTACTAAATTAGATATAGTGAGGTAAGAAGTTTTTTT TGCAATATTTATGTTTTGAATTTTTACAGGTCACTCAATTGCTCACATTA TTACTTTATGGAGTATTTTAGTTAGTATATGAATACCTATAGTTATTAAA GTTTTGCATTTTTGAGAGATGTAACTTAAACTCAGTATTTTTAAAAAACC TGGCTCACACTAAACTTCATTTAAACAGGTATTCTTAATGTTTTGACAAC AAATCGCTGAGTTGCGATCCTATTGAGTAATCGTTCTATCGAAAATGACC TTTGTGAATATGGATTTAGAACTGTTTTCCAATGAGACTACTTTTGAATG TCAGCGAAAGCCAAAGATGATACTGAGTGGGTGACCTTTTTGGCAACACA TTTTTTGTCTCTTTTTATTTCCAAATAAAGTTTTTTTCTTTTTTTTTATA AAGGTATAGTAGACAGATCCTACTACCAGATATTGGTGTAACGGGGCAAG AAAAGCTGTGCGCTGCTAAGGTTTTGGTCGTCGGTGCAGGAGGATTAGGC TGCCCTGCTGCGATGTACTTAGCTGGNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATCCGCTA AGGACGGATTTTACGAATCTCCACCCCTAAGGGGGTAAAACGGGATCCAC GCGTACGAAGTCGCGGGCGGCCGCTAATATATTATAAAATTGTTTATTGA AAAAATAATTACTCCAGTAACAACCAGTGCAATAAATAAATCTCAATTTG AAGTATTTAAAACATTTTTTTCCAACAGCATCAACTCACATATCAAGGTA CAACCGTACAATGTACAGTTGGATTCGACGAACGCTCTGGATATCGCGTC GCGATACGACGTCGTGCTTGACTGTACTGACAACGTGCCTACAAGATATT TGTTGAACGACGCTTGTGCGATTACCAAG
back to top

Coding sequence (CDS) from alignment at newscf_19953:13..3091+

>OSCA020362-RA ID=OSCA020362-RA|Name=OSCA020362-RA|organism=Ostrinia scapulalis|type=CDS|length=297bp|location=Sequence derived from alignment at newscf_19953:13..3091+ (Ostrinia scapulalis)
ATGGGTGACAAACTTACTAAATTAGATATAGTGAGGTATAGTAGACAGAT
CCTACTACCAGATATTGGTGTAACGGGGCAAGAAAAGCTGTGCGCTGCTA
AGGTTTTGGTCGTCGGTGCAGGAGGATTAGGCTGCCCTGCTGCGATCATC
AACTCACATATCAAGGTACAACCGTACAATGTACAGTTGGATTCGACGAA
CGCTCTGGATATCGCGTCGCGATACGACGTCGTGCTTGACTGTACTGACA
ACGTGCCTACAAGATATTTGTTGAACGACGCTTGTGCGATTACCAAG
back to top
Synonyms
The feature 'OSCA020362-RA' has the following synonyms
Synonym
maker-newscf_19953-snap-gene-0.1-mRNA-1