OSCA020507-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA020507-RA
Unique NameOSCA020507-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length441
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_17939contignewscf_17939:4..1260 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.14
QI0|0|0|1|1|0.66|3|0|147
AED0.14
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA020507OSCA020507Ostrinia scapulalisgenenewscf_17939 4..1260 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020507-RAOSCA020507-PAOstrinia scapulalispolypeptidenewscf_17939 4..1260 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020507-RA:exon:3334OSCA020507-RA:exon:3334Ostrinia scapulalisexonnewscf_17939 4..179 +
OSCA020507-RA:exon:3335OSCA020507-RA:exon:3335Ostrinia scapulalisexonnewscf_17939 296..449 +
OSCA020507-RA:exon:3336OSCA020507-RA:exon:3336Ostrinia scapulalisexonnewscf_17939 1150..1260 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020507-RA:cdsOSCA020507-RA:cdsOstrinia scapulalisCDSnewscf_17939 1150..1260 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA020507-RA ID=OSCA020507-RA|Name=OSCA020507-RA|organism=Ostrinia scapulalis|type=mRNA|length=441bp
TGCCGCAAGGAGTACAACTACCAGTTCAACCCTCAGAACAGCAACTACGT
GGAGTGGCACGAGCGAGAGACCAGAGGCAAGACCGTGAAGGAACGGTTGT
CGCTGGTCTACGTGGCCAAGGCCTACCTCACGGCTGTCAGCGTCACGGAG
AAAAGGAATTTGATCTGGGACTTAAGGAGTCTTTTGGCAAGGGACCCCAA
GGGCCACCTGCAGGCCGGTATCTATTTCTACATCAAGCCGAAGGACCAGC
AGTTCACCATGTTCTTCAACAGCAATAGCGGAAAGCAGAGGAAGAAGCTC
AAGTTTGAAACCTTCTTGGAGCTTCAGAAGATTCCCGACGAAGTAGTAGA
CGAAGTGGAACAGTGCAACGACCAACTGCACCTGAGGGATGGTGAGCTTC
TGTCAATCTTGAACCGGCTGGCGAACATCATGGCCGACCAG
back to top

spliced messenger RNA

>OSCA020507-RA ID=OSCA020507-RA|Name=OSCA020507-RA|organism=Ostrinia scapulalis|type=mRNA|length=441bp|location=Sequence derived from alignment at newscf_17939:4..1260+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
TGCCGCAAGGAGTACAACTACCAGTTCAACCCTCAGAACAGCAACTACGT
GGAGTGGCACGAGCGAGAGACCAGAGGCAAGACCGTGAAGGAACGGTTGT
CGCTGGTCTACGTGGCCAAGGCCTACCTCACGGCTGTCAGCGTCACGGAG
AAAAGGAATTTGATCTGGGACTTAAGGAGTCTTTTGGCAAGGGACCCCAA
GGGCCACCTGCAGGCCGGTATCTATTTCTACATCAAGCCGAAGGACCAGC
AGTTCACCATGTTCTTCAACAGCAATAGCGGAAAGCAGAGGAAGAAGCTC
AAGTTTGAAACCTTCTTGGAGCTTCAGAAGATTCCCGACGAAGTAGTAGA
CGAAGTGGAACAGTGCAACGACCAACTGCACCTGAGGGATGGTGAGCTTC
TGTCAATCTTGAACCGGCTGGCGAACATCATGGCCGACCAG
back to top

protein sequence of OSCA020507-RA

>OSCA020507-PA ID=OSCA020507-PA|Name=OSCA020507-RA|organism=Ostrinia scapulalis|type=polypeptide|length=147bp
CRKEYNYQFNPQNSNYVEWHERETRGKTVKERLSLVYVAKAYLTAVSVTE
KRNLIWDLRSLLARDPKGHLQAGIYFYIKPKDQQFTMFFNSNSGKQRKKL
KFETFLELQKIPDEVVDEVEQCNDQLHLRDGELLSILNRLANIMADQ
back to top

mRNA from alignment at newscf_17939:4..1260+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA020507-RA ID=OSCA020507-RA|Name=OSCA020507-RA|organism=Ostrinia scapulalis|type=mRNA|length=1257bp|location=Sequence derived from alignment at newscf_17939:4..1260+ (Ostrinia scapulalis)
TGCCGCAAGGAGTACAACTACCAGTTCAACCCTCAGAACAGCAACTACGT GGAGTGGCACGAGCGAGAGACCAGAGGCAAGACCGTGAAGGAACGGTTGT CGCTGGTCTACGTGGCCAAGGCCTACCTCACGGCTGTCAGCGTCACGGAG AAAAGGAATTTGATCTGGGACTTAAGGTTAGTATTCATTAATTTACCAAG ATTTTTGGGAATGAGAGCACCTACCTACTTTTTCTTACTACAAAAAACTA AAAAGAAAAGGACAGTAAATAAAGATGATATTCTTTTTACAGGAGTCTTT TGGCAAGGGACCCCAAGGGCCACCTGCAGGCCGGTATCTATTTCTACATC AAGCCGAAGGACCAGCAGTTCACCATGTTCTTCAACAGCAATAGCGGAAA GCAGAGGAAGAAGCTCAAGTTTGAAACCTTCTTGGAGCTTCAGAAGGTAA TTAATCTTTTGAAATTATAATAGAAATTGATCTAGTAATCTGTCATATTT TCTTAGCTTAAGGGATGATGGGAAATGGGAAAACCGTGACCCAAATCAGA AACACTGGTAGGTATAGAGTGTATCTTTGGCCTGATCTTGGCTTTTAGCA CAAATAGCGCTCATTGAAGAAAACAGTCTGGAAGCTAAATATAGGCATTA CTGACGTCAGCCGCATCCCATATTTCCATAGATTGGAAGATAGCCAATGC AACGGCATATCCCAAATATTATGTTGCCAAAAATGTGTCTGGATAAAATT TATTTAAAAACTTTCACTGAAGACGCATTCCTATTGGCATTTAAAGCTCT TTTCTGAAAACGGGGCTGAAATATGAGGGTTAAGCTGAACTTGTACTAAA TTGTAACAGATTTAGGAATCTTACCAGTACCATAATGAAGAGTCAAATGA GAGTGCATCGAGTGTAATGATATTTATTTTAAAAGGTCTTACTTTGTAAC CATTGGTAATATAGGCTCACATTATGTAGATACTCATAGTATCGTAATCC TGTGCAAAATTAGATCAACTCTGGAGACTTCGTAAATAAATTAGAATCAA CCTTTTCTAAGACGGTCTCGAGCATGATAGATGTATAGGCGATTAAAGTT GTTGCTGATGCAAATTGTGCTTTAACTCCTACTCCTTAACTTCCAGATTC CCGACGAAGTAGTAGACGAAGTGGAACAGTGCAACGACCAACTGCACCTG AGGGATGGTGAGCTTCTGTCAATCTTGAACCGGCTGGCGAACATCATGGC CGACCAG
back to top

Coding sequence (CDS) from alignment at newscf_17939:4..1260+

>OSCA020507-RA ID=OSCA020507-RA|Name=OSCA020507-RA|organism=Ostrinia scapulalis|type=CDS|length=441bp|location=Sequence derived from alignment at newscf_17939:4..1260+ (Ostrinia scapulalis)
TGCCGCAAGGAGTACAACTACCAGTTCAACCCTCAGAACAGCAACTACGT
GGAGTGGCACGAGCGAGAGACCAGAGGCAAGACCGTGAAGGAACGGTTGT
CGCTGGTCTACGTGGCCAAGGCCTACCTCACGGCTGTCAGCGTCACGGAG
AAAAGGAATTTGATCTGGGACTTAAGGAGTCTTTTGGCAAGGGACCCCAA
GGGCCACCTGCAGGCCGGTATCTATTTCTACATCAAGCCGAAGGACCAGC
AGTTCACCATGTTCTTCAACAGCAATAGCGGAAAGCAGAGGAAGAAGCTC
AAGTTTGAAACCTTCTTGGAGCTTCAGAAGATTCCCGACGAAGTAGTAGA
CGAAGTGGAACAGTGCAACGACCAACTGCACCTGAGGGATGGTGAGCTTC
TGTCAATCTTGAACCGGCTGGCGAACATCATGGCCGACCAG
back to top
Synonyms
The feature 'OSCA020507-RA' has the following synonyms
Synonym
maker-newscf_17939-augustus-gene-0.2-mRNA-1