OSCA020574-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA020574-RA
Unique NameOSCA020574-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length357
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19970contignewscf_19970:3..750 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.13
QI0|0|0|0.66|0.5|0.66|3|0|119
AED0.13
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA020574OSCA020574Ostrinia scapulalisgenenewscf_19970 3..750 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020574-RAOSCA020574-PAOstrinia scapulalispolypeptidenewscf_19970 3..750 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020574-RA:cdsOSCA020574-RA:cdsOstrinia scapulalisCDSnewscf_19970 3..155 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020574-RA:exon:2494OSCA020574-RA:exon:2494Ostrinia scapulalisexonnewscf_19970 3..155 -
OSCA020574-RA:exon:2495OSCA020574-RA:exon:2495Ostrinia scapulalisexonnewscf_19970 325..379 -
OSCA020574-RA:exon:2496OSCA020574-RA:exon:2496Ostrinia scapulalisexonnewscf_19970 602..750 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA020574-RA ID=OSCA020574-RA|Name=OSCA020574-RA|organism=Ostrinia scapulalis|type=mRNA|length=357bp
ATGAAAGTGATAGAGCCCGACAAAGAGATAGGGCTGCTAGACGCCGACGT
CTTCGGCCCGTCCGTGCCGCTCATGATGAACATCAGTGGGGAGCCCATGC
TCAACGATGATAACCTCATAGAGCCACTATTGAATTATGGTGTCAAATGG
GCCTGTCCAGATGACGAGTTTTTACTCGCGAGTTTCGAATCGCGCGATAG
TGAGCATGTCAATTATTATCTACTAATTATCCTATCCTTCTTAATTTGTA
GTATGTCAATGGGCCTGCTAGTATCGGGCGAGAACGCGGTAGTGTGGCGC
GGTCTGATGGTGATGCAAGCGCTGGAGAGACTGACGCGGCACGTGGCGTG
GGGCCCG
back to top

spliced messenger RNA

>OSCA020574-RA ID=OSCA020574-RA|Name=OSCA020574-RA|organism=Ostrinia scapulalis|type=mRNA|length=357bp|location=Sequence derived from alignment at newscf_19970:3..750- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGAAAGTGATAGAGCCCGACAAAGAGATAGGGCTGCTAGACGCCGACGT
CTTCGGCCCGTCCGTGCCGCTCATGATGAACATCAGTGGGGAGCCCATGC
TCAACGATGATAACCTCATAGAGCCACTATTGAATTATGGTGTCAAATGG
GCCTGTCCAGATGACGAGTTTTTACTCGCGAGTTTCGAATCGCGCGATAG
TGAGCATGTCAATTATTATCTACTAATTATCCTATCCTTCTTAATTTGTA
GTATGTCAATGGGCCTGCTAGTATCGGGCGAGAACGCGGTAGTGTGGCGC
GGTCTGATGGTGATGCAAGCGCTGGAGAGACTGACGCGGCACGTGGCGTG
GGGCCCG
back to top

protein sequence of OSCA020574-RA

>OSCA020574-PA ID=OSCA020574-PA|Name=OSCA020574-RA|organism=Ostrinia scapulalis|type=polypeptide|length=119bp
MKVIEPDKEIGLLDADVFGPSVPLMMNISGEPMLNDDNLIEPLLNYGVKW
ACPDDEFLLASFESRDSEHVNYYLLIILSFLICSMSMGLLVSGENAVVWR
GLMVMQALERLTRHVAWGP
back to top

mRNA from alignment at newscf_19970:3..750-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA020574-RA ID=OSCA020574-RA|Name=OSCA020574-RA|organism=Ostrinia scapulalis|type=mRNA|length=748bp|location=Sequence derived from alignment at newscf_19970:3..750- (Ostrinia scapulalis)
ATGAAAGTGATAGAGCCCGACAAAGAGATAGGGCTGCTAGACGCCGACGT CTTCGGCCCGTCCGTGCCGCTCATGATGAACATCAGTGGGGAGCCCATGC TCAACGATGATAACCTCATAGAGCCACTATTGAATTATGGTGTCAAATGG TGAGTTTATTCTTTTAATATTTTCTTGATGGTATGTATTATTACCATTGT ATTTTCACACAAATAAGATTTTAGCTGGTTTACAGTCCATGTTTTCCTTT TAAAACTATAGTAGCACAGCCTTAAATATACCTATAAGATTAGAAGTTTG GACTTCTATTTGAGAGAAGGCTTTAGAGGCATTTGGGAAGTCGCGTCTTT GTAATCTTGAAGCTTGTTTAGGGCCTGTCCAGATGACGAGTTTTTACTCG CGAGTTTCGAATCGCGCGATAGTGAGGTACTAGAGGTTCATACATTCTGT CCACATGCAGTCGCGCGTTTCGCCTAAGAATCTTAATCGCGCGATTCAAA ACGCGCAAGTAAAAACGCGTCATCTGGACATAGCCTTTCCAGGGGAGGCA CTTAGAAAATCTTATTCCATCCTTGTAATCTTTATTTCTTTCTAGCATGT CAATTATTATCTACTAATTATCCTATCCTTCTTAATTTGTAGTATGTCAA TGGGCCTGCTAGTATCGGGCGAGAACGCGGTAGTGTGGCGCGGTCTGATG GTGATGCAAGCGCTGGAGAGACTGACGCGGCACGTGGCGTGGGGCCCG
back to top

Coding sequence (CDS) from alignment at newscf_19970:3..750-

>OSCA020574-RA ID=OSCA020574-RA|Name=OSCA020574-RA|organism=Ostrinia scapulalis|type=CDS|length=357bp|location=Sequence derived from alignment at newscf_19970:3..750- (Ostrinia scapulalis)
ATGAAAGTGATAGAGCCCGACAAAGAGATAGGGCTGCTAGACGCCGACGT
CTTCGGCCCGTCCGTGCCGCTCATGATGAACATCAGTGGGGAGCCCATGC
TCAACGATGATAACCTCATAGAGCCACTATTGAATTATGGTGTCAAATGG
GCCTGTCCAGATGACGAGTTTTTACTCGCGAGTTTCGAATCGCGCGATAG
TGAGCATGTCAATTATTATCTACTAATTATCCTATCCTTCTTAATTTGTA
GTATGTCAATGGGCCTGCTAGTATCGGGCGAGAACGCGGTAGTGTGGCGC
GGTCTGATGGTGATGCAAGCGCTGGAGAGACTGACGCGGCACGTGGCGTG
GGGCCCG
back to top
Synonyms
The feature 'OSCA020574-RA' has the following synonyms
Synonym
maker-newscf_19970-augustus-gene-0.1-mRNA-1