OSCA020774-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA020774-RA
Unique NameOSCA020774-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length4983
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_11477contignewscf_11477:478..5966 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.02
QI0|0|0|1|1|1|3|0|1660
AED0.02
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA020774OSCA020774Ostrinia scapulalisgenenewscf_11477 478..5966 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020774-RAOSCA020774-PAOstrinia scapulalispolypeptidenewscf_11477 478..5966 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020774-RA:cdsOSCA020774-RA:cdsOstrinia scapulalisCDSnewscf_11477 478..665 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA020774-RA:exon:2328OSCA020774-RA:exon:2328Ostrinia scapulalisexonnewscf_11477 478..665 -
OSCA020774-RA:exon:2329OSCA020774-RA:exon:2329Ostrinia scapulalisexonnewscf_11477 963..1164 -
OSCA020774-RA:exon:2330OSCA020774-RA:exon:2330Ostrinia scapulalisexonnewscf_11477 1374..5966 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA020774-RA ID=OSCA020774-RA|Name=OSCA020774-RA|organism=Ostrinia scapulalis|type=mRNA|length=4983bp
ATGGGTCCCAAGAAGGGTAAAGATGTCGTAGATGAAAACTATTGGCGTAC
CTGTATAGAAGAAGCTCCACTAGATGAAGAGACTTGGAAAGTCAAGGTGG
TTCTTATAGAAGCAGCTGGAAGTGACCAAGATCGCATTTATTTGAACAAG
TTTGAAACTTTTGCCGCTGAAGAGAAGAGATTTGTAATAAAAAATATCTG
CAAGACTGAAACGACCTTCATGATTAACCAGTTGGGTGGAGAGAAGAAAG
TAAAAGATGACAATCTTCGCGTCTTCGAAGAAGGCCAGGCNTTTCTTAAA
GACAAAAAGGATATACCCCCGGATATACTAGCACTGATAATTAAACATNT
NATTTTAAAAATGAAAGATGAATATCTTTTTATAAAACGCCAAAGATTGG
AAGTTAAGGAAGGAATGCGAAGAGAATCTACAACCATGGTTAATAGAGCA
GAAGTTAGAGGAACTGTCAGCGTNAAGCCTCCAGATCCACCAGAACCCGA
ACCGCCCCCAAAAGCTAAGGGTAAAAAGGGCGAACCAGAGCCATTACCTC
AAACTCCAGAGCCATCCGAGGGAAAGAAATATAATACGCAGTTACGCGTT
AGAGGAGAAGAATGGAGAGACAAAGTTTACGTTGATGATTTCCCTACAGA
TGGTCCTAATCTTTATGTTGCTATAACTGGCTTTGTGGAACCTTACTTAC
CTGGAGCACTTGTCAAAATTGGAATTCCGCTCACGGCAGTGGTTCAAATA
CGGATCGATTCATCTACAACTCGAGTGCCTTCAAGCTTACTGAGACCCAG
CAAAAGAGGACAAAGCCAAACAGAAATTTTAACTGAGAAATCTTTNAAGT
TTTGGGATGATTTACAGCAGCTGAGAATTCACAGAGATTCAGCTGATGAT
TTTAAGAACACTGCTTTTGTTGTTTTCGCACCNCCGTACTGGGATTCCGA
GAGCTTATCTGGCAGTCCGGATAAAATTTATGACGAATTGTGTTACCTAA
TGTACGATATTCAAGATTTAACGCGACAACATACGCATTATTTAGAAAAC
ATGGAAATTATCAATATCCCCATGGACTTTAATGACGAGCGATATATCAA
GTATTATTATCAACAAATACAAGATCTGCCTCTGGAATGCGTTACCATAT
ATTCGCTTTTGGATAGTGTACTTCACACCGTTGAAAAAAGTCATGAAATT
GATGAAAAAAGTAGCAGGACGTCACTGTCCACTGCTTTGACTATAAACCA
ACCTCGAAAAAGTGGTGACGAGGATGGTAAAATAGCAAAGGCGGAAACCC
TTGTTAGAGATGTTTTCAGTACATTATGTAAAACTGAATCTCAGAAAAAA
GCTTACCGTCTCACATATGGCGATGAATATGAAAATCATAAAGATCCTAT
AATAATACATTACGGAGATATAGCGAAGTATAACACCTTTCACCTGGGAA
ATATCAATTTAGATAATATAGTTTGGACAACATTATTTGGAATGCCTATC
AACCAATTGTGGCAGAATCAAAACAGACCCCAAGGCGAGATAGAGGCCAA
AATAAATTTTCACATTAATGTACTTCTTACATGTTTTGATCGAGAAGACG
TGGAAACAGCGGAGCTAAATAGACTAATCCACATATTAGCCTGTCGAAAA
TTATACAATAATAGAAGTTCTCTTAAAAAAAAGCACTTGCCATCTTCAAC
AATATCAGAATTTAAAAAAGTATATTTAAAACGCAGTGTTTTAGCTGAAC
CACTACCTAAATGTCCCTCATTTATNAAGAGTTCTAGTTCAACATCTCCT
TCATTTCCCTCAATGACAAAAAGTGAAAATGTATCAGGCGCTTCCTACAG
CGATGACCCCGAAGTTTGTCGAATAAGATTTCTTTTTGACTGTCCTGACA
TAAGCGAACTGGTATCTGCCGCCGAAATCTCAAATGAGCAGCCAATCAAT
CACATGATTGATGATTTTGAACATTTTGAAGATTTCTCTGGAGTTAGTGC
CTTTCAAATTATGCGAGATGCATTTAACAGCTTTAATTGTGTTGATTACA
AGTACTGTGAAGTTACTGACAGTTTCATATTAATGTTTTTTAATAGTCAC
GACAAAGACGGCATTGCCCGAGAAGAGTGGAGGTGTCATATTCCTACTCC
ATTGTGTTTGCAAGATTTTTTCGACTTTGTCCTTGAAGAGCATTATGACT
GGATTCAAAATGAAGAAAAAATTTATGACGAAAATGTTGTCTTGAAATCA
CAATCTGAATGCAAAGAAATTATTGATCCTTTTGCAATTAAATCGTGTGT
AGAAAATACAGAAGTGGAATTAGAACTTCTGATGGAAGGTTCTCTAAAAT
TTCAAGAACTTGCAGTTATGGAAGAAGCTAGTGTTGAAGCGTCGGAAACC
AAAATTACTTCTAAAAAAACTACAATGTCACCGAGCTCAACTGAAGTAGA
TTCTAAGAGCAGTAGAAAACCAAAATCCTCTGCGGCATCCACACCAAAGA
ATTTGAGGCAATCATTTATGGCAATGGGAACTGATTCAAATGCTTCAATT
GAAATACCTGCTAAACCTTTTTCTGGGTATGATTTGGGCGATAGAAGAGT
TGAAGTTTTTGGACAAAACTCGACGTTCTTCTCCAAAGATGGAACACAAG
TGATAAGTAAATATTCGTTAACGATACCAATGAATTTGGAATACATCATT
TTGAATGTTGTCCCTGGAAATGGTATAAATGAGTTTTGGTTGCATAGAGC
TTTGGGTGAATATGTTACTCCCGAAATATTAGATATCTGCGAATCATTCA
GAATAACTAGCAAAGATCAAGTTATGATTAATGTTAAAAAGCAGACATAC
CAAGTACCAATACCTATGATGTCAATGTCTTTCATAGACTCAAAACCAAA
AGAAAGCATGTATAAGCCATCTACTGAAAGATATGGTGATGGAATTCCTC
AAATATTTGAGTCAAAATATTTTCATTCTCTTTTCATTACTTGGCCTAAT
GGATTAATAACTGAAAGTGTTCATCTGGACAATTCACCCGATATATCACA
CATCAAACAGTATTTTATAGATCCAATGCCACACCTTGACGAAGAAATGC
GTTGTATAAGTTTAAATGGTGAGGTAATAGTGTTTCGGCCATCTGGTATT
ATAGAAGTGTTGCGTCCAGATGGATCTTTTATTAAAATAACCAAATGCGA
AAAAAGGATTGTCCAAACAGAGCCACCTGAAGATATGCACAGCGAAACCA
GTTCTGACAAAAGCAAAAAAGGAAAAGGTAAAGAGAAAGATAAAAAGGAA
AAGCCCAGCAAAGCTTCTTCTAAATCATCAAAAAATGCTATCGCCGACGA
CGGTTCGGAAATAAAACCGCCTGAATATGAATTAGTCATAGAAGAATTTG
AAACTATTGAAACAAATGGATTGAGGCAAAAATGGGTAGATGAAATCCCA
ACACCAATTGAGAAGCTATTNATAAGAACAGCCACGGACTATTGTTTAGG
AGAAGTTTTTTCTAGACGAATGGATGGTACAAATTCTTTGCTTAATAAAG
ATGGTGTTCATGTAGTGACTTTTCCAAACAATACTAGAATTATTACTACC
TATTTTATTGAAGAAGAGGAAGTTTTCCCTGAATGGACAGACGAAGAAAA
AGAATATTTTGATTTGTTCGATTCTGATACAGTAGAGACGGATACTCTTA
AATCTAAAGCGTCAATGTCTCAAAAAAGTTACATTGGAACTTACACATAC
AGCAGCGTAGCTAGTTCAGCTTCCAAAAAAATTGGAGAAGAAGAGGAAGA
AACCAAAGAAAAAGAAAGAACTGACGGTTACGTATCTGTACAAATAATTT
TAACTATAGAACATGCCAATTTTACTACAATTACATTAAATAAAGCGGAT
AACAAAATATCTGTAGATTCTCCAAACAAAAGTAAAGTAGTAATGGATAG
TGAAAATCACTATGATATATACCTTGACAGTGCAACATCAGCTAAGTTCG
ATGGCCAGTCATTACATGTTAATTTCGAAGCTTGTTCGGAATGCCGGTCT
AATACCACATCTACCATTAAAGTAAAAACTGATGATATGAGCAGTGTAAC
AAAAATGCACCAGCATTGGTTGAGAATGAAAGATTCGTTTTGTAAAAAAG
TTATTGTAAATGAAGAGGGCCATATTTCCATCATGGATGAACCGTGTTCT
ACTGAAGTGTACACCAGCGAAGAAGTTACAAATACAGAAGAATGTCACGA
TAGTGAGCAGAAGCCATTAGATGCCAAGTCAGANAATTCTTTTGTCGCCC
ATGGTAAATGTAGAGAGATGTACTTGGCAAAGACAATTAGATTTTTTGTT
CTTCGACGGTACGTATGCCTACAGAGAGTAAATTTTTTAAGATGCAGTTT
AGTATTTAGGCTTACGCTAAGATGTTGTTTCAGTGAGTTATCATGTTCAG
AGCTCGTACATCGAGCGTTACTTGAGCAGCACAAGAAAGCTTGTCGCTGG
CAGCCCTGGTGCTCTATCAATCAGTACGACACATTTGGGGATCATCGCAA
CCTTNTGTCCATTCTTACTCCTATCCACCTGACGGAGACTGAGAAATGGC
TGATGGATTCGAAGCTGGCAGATAAACCGAAGTATCTTACCTACAAGGAC
CTGAAGAAAGACTCTGGTAAAGGCTTCTACCATTGGATGAGGCCCTATGA
GAGGTTTCAGCCGAAGCCAATGAAACCGAGCAATGTTTTGCCTCCTAGAC
TACCAAAGGCGTTTTTATTGAGGTCTTGTATCAAATCTTCGCTAAAGCAG
CAGTGGAAGGAAAGTGAAAGGGCCAAGTTGAAGGGCGCGAAAGAGCTGCT
GTCGGCCATATTGCGGTACCGCCGGGTCATGGAGTCCGACAGCGAGACAA
TACTGCACGTGCCTATCAGGGATACGAGATCGGACGAGGAGAGGTGCACA
GACGACATCATTCAAGCTTTAGGACACAGGTGA
back to top

spliced messenger RNA

>OSCA020774-RA ID=OSCA020774-RA|Name=OSCA020774-RA|organism=Ostrinia scapulalis|type=mRNA|length=4983bp|location=Sequence derived from alignment at newscf_11477:478..5966- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGGTCCCAAGAAGGGTAAAGATGTCGTAGATGAAAACTATTGGCGTAC
CTGTATAGAAGAAGCTCCACTAGATGAAGAGACTTGGAAAGTCAAGGTGG
TTCTTATAGAAGCAGCTGGAAGTGACCAAGATCGCATTTATTTGAACAAG
TTTGAAACTTTTGCCGCTGAAGAGAAGAGATTTGTAATAAAAAATATCTG
CAAGACTGAAACGACCTTCATGATTAACCAGTTGGGTGGAGAGAAGAAAG
TAAAAGATGACAATCTTCGCGTCTTCGAAGAAGGCCAGGCRTTTCTTAAA
GACAAAAAGGATATACCCCCGGATATACTAGCACTGATAATTAAACATYT
MATTTTAAAAATGAAAGATGAATATCTTTTTATAAAACGCCAAAGATTGG
AAGTTAAGGAAGGAATGCGAAGAGAATCTACAACCATGGTTAATAGAGCA
GAAGTTAGAGGAACTGTCAGCGTYAAGCCTCCAGATCCACCAGAACCCGA
ACCGCCCCCAAAAGCTAAGGGTAAAAAGGGCGAACCAGAGCCATTACCTC
AAACTCCAGAGCCATCCGAGGGAAAGAAATATAATACGCAGTTACGCGTT
AGAGGAGAAGAATGGAGAGACAAAGTTTACGTTGATGATTTCCCTACAGA
TGGTCCTAATCTTTATGTTGCTATAACTGGCTTTGTGGAACCTTACTTAC
CTGGAGCACTTGTCAAAATTGGAATTCCGCTCACGGCAGTGGTTCAAATA
CGGATCGATTCATCTACAACTCGAGTGCCTTCAAGCTTACTGAGACCCAG
CAAAAGAGGACAAAGCCAAACAGAAATTTTAACTGAGAAATCTTTRAAGT
TTTGGGATGATTTACAGCAGCTGAGAATTCACAGAGATTCAGCTGATGAT
TTTAAGAACACTGCTTTTGTTGTTTTCGCACCRCCGTACTGGGATTCCGA
GAGCTTATCTGGCAGTCCGGATAAAATTTATGACGAATTGTGTTACCTAA
TGTACGATATTCAAGATTTAACGCGACAACATACGCATTATTTAGAAAAC
ATGGAAATTATCAATATCCCCATGGACTTTAATGACGAGCGATATATCAA
GTATTATTATCAACAAATACAAGATCTGCCTCTGGAATGCGTTACCATAT
ATTCGCTTTTGGATAGTGTACTTCACACCGTTGAAAAAAGTCATGAAATT
GATGAAAAAAGTAGCAGGACGTCACTGTCCACTGCTTTGACTATAAACCA
ACCTCGAAAAAGTGGTGACGAGGATGGTAAAATAGCAAAGGCGGAAACCC
TTGTTAGAGATGTTTTCAGTACATTATGTAAAACTGAATCTCAGAAAAAA
GCTTACCGTCTCACATATGGCGATGAATATGAAAATCATAAAGATCCTAT
AATAATACATTACGGAGATATAGCGAAGTATAACACCTTTCACCTGGGAA
ATATCAATTTAGATAATATAGTTTGGACAACATTATTTGGAATGCCTATC
AACCAATTGTGGCAGAATCAAAACAGACCCCAAGGCGAGATAGAGGCCAA
AATAAATTTTCACATTAATGTACTTCTTACATGTTTTGATCGAGAAGACG
TGGAAACAGCGGAGCTAAATAGACTAATCCACATATTAGCCTGTCGAAAA
TTATACAATAATAGAAGTTCTCTTAAAAAAAAGCACTTGCCATCTTCAAC
AATATCAGAATTTAAAAAAGTATATTTAAAACGCAGTGTTTTAGCTGAAC
CACTACCTAAATGTCCCTCATTTATKAAGAGTTCTAGTTCAACATCTCCT
TCATTTCCCTCAATGACAAAAAGTGAAAATGTATCAGGCGCTTCCTACAG
CGATGACCCCGAAGTTTGTCGAATAAGATTTCTTTTTGACTGTCCTGACA
TAAGCGAACTGGTATCTGCCGCCGAAATCTCAAATGAGCAGCCAATCAAT
CACATGATTGATGATTTTGAACATTTTGAAGATTTCTCTGGAGTTAGTGC
CTTTCAAATTATGCGAGATGCATTTAACAGCTTTAATTGTGTTGATTACA
AGTACTGTGAAGTTACTGACAGTTTCATATTAATGTTTTTTAATAGTCAC
GACAAAGACGGCATTGCCCGAGAAGAGTGGAGGTGTCATATTCCTACTCC
ATTGTGTTTGCAAGATTTTTTCGACTTTGTCCTTGAAGAGCATTATGACT
GGATTCAAAATGAAGAAAAAATTTATGACGAAAATGTTGTCTTGAAATCA
CAATCTGAATGCAAAGAAATTATTGATCCTTTTGCAATTAAATCGTGTGT
AGAAAATACAGAAGTGGAATTAGAACTTCTGATGGAAGGTTCTCTAAAAT
TTCAAGAACTTGCAGTTATGGAAGAAGCTAGTGTTGAAGCGTCGGAAACC
AAAATTACTTCTAAAAAAACTACAATGTCACCGAGCTCAACTGAAGTAGA
TTCTAAGAGCAGTAGAAAACCAAAATCCTCTGCGGCATCCACACCAAAGA
ATTTGAGGCAATCATTTATGGCAATGGGAACTGATTCAAATGCTTCAATT
GAAATACCTGCTAAACCTTTTTCTGGGTATGATTTGGGCGATAGAAGAGT
TGAAGTTTTTGGACAAAACTCGACGTTCTTCTCCAAAGATGGAACACAAG
TGATAAGTAAATATTCGTTAACGATACCAATGAATTTGGAATACATCATT
TTGAATGTTGTCCCTGGAAATGGTATAAATGAGTTTTGGTTGCATAGAGC
TTTGGGTGAATATGTTACTCCCGAAATATTAGATATCTGCGAATCATTCA
GAATAACTAGCAAAGATCAAGTTATGATTAATGTTAAAAAGCAGACATAC
CAAGTACCAATACCTATGATGTCAATGTCTTTCATAGACTCAAAACCAAA
AGAAAGCATGTATAAGCCATCTACTGAAAGATATGGTGATGGAATTCCTC
AAATATTTGAGTCAAAATATTTTCATTCTCTTTTCATTACTTGGCCTAAT
GGATTAATAACTGAAAGTGTTCATCTGGACAATTCACCCGATATATCACA
CATCAAACAGTATTTTATAGATCCAATGCCACACCTTGACGAAGAAATGC
GTTGTATAAGTTTAAATGGTGAGGTAATAGTGTTTCGGCCATCTGGTATT
ATAGAAGTGTTGCGTCCAGATGGATCTTTTATTAAAATAACCAAATGCGA
AAAAAGGATTGTCCAAACAGAGCCACCTGAAGATATGCACAGCGAAACCA
GTTCTGACAAAAGCAAAAAAGGAAAAGGTAAAGAGAAAGATAAAAAGGAA
AAGCCCAGCAAAGCTTCTTCTAAATCATCAAAAAATGCTATCGCCGACGA
CGGTTCGGAAATAAAACCGCCTGAATATGAATTAGTCATAGAAGAATTTG
AAACTATTGAAACAAATGGATTGAGGCAAAAATGGGTAGATGAAATCCCA
ACACCAATTGAGAAGCTATTRATAAGAACAGCCACGGACTATTGTTTAGG
AGAAGTTTTTTCTAGACGAATGGATGGTACAAATTCTTTGCTTAATAAAG
ATGGTGTTCATGTAGTGACTTTTCCAAACAATACTAGAATTATTACTACC
TATTTTATTGAAGAAGAGGAAGTTTTCCCTGAATGGACAGACGAAGAAAA
AGAATATTTTGATTTGTTCGATTCTGATACAGTAGAGACGGATACTCTTA
AATCTAAAGCGTCAATGTCTCAAAAAAGTTACATTGGAACTTACACATAC
AGCAGCGTAGCTAGTTCAGCTTCCAAAAAAATTGGAGAAGAAGAGGAAGA
AACCAAAGAAAAAGAAAGAACTGACGGTTACGTATCTGTACAAATAATTT
TAACTATAGAACATGCCAATTTTACTACAATTACATTAAATAAAGCGGAT
AACAAAATATCTGTAGATTCTCCAAACAAAAGTAAAGTAGTAATGGATAG
TGAAAATCACTATGATATATACCTTGACAGTGCAACATCAGCTAAGTTCG
ATGGCCAGTCATTACATGTTAATTTCGAAGCTTGTTCGGAATGCCGGTCT
AATACCACATCTACCATTAAAGTAAAAACTGATGATATGAGCAGTGTAAC
AAAAATGCACCAGCATTGGTTGAGAATGAAAGATTCGTTTTGTAAAAAAG
TTATTGTAAATGAAGAGGGCCATATTTCCATCATGGATGAACCGTGTTCT
ACTGAAGTGTACACCAGCGAAGAAGTTACAAATACAGAAGAATGTCACGA
TAGTGAGCAGAAGCCATTAGATGCCAAGTCAGAKAATTCTTTTGTCGCCC
ATGGTAAATGTAGAGAGATGTACTTGGCAAAGACAATTAGATTTTTTGTT
CTTCGACGGTACGTATGCCTACAGAGAGTAAATTTTTTAAGATGCAGTTT
AGTATTTAGGCTTACGCTAAGATGTTGTTTCAGTGAGTTATCATGTTCAG
AGCTCGTACATCGAGCGTTACTTGAGCAGCACAAGAAAGCTTGTCGCTGG
CAGCCCTGGTGCTCTATCAATCAGTACGACACATTTGGGGATCATCGCAA
CCTTYTGTCCATTCTTACTCCTATCCACCTGACGGAGACTGAGAAATGGC
TGATGGATTCGAAGCTGGCAGATAAACCGAAGTATCTTACCTACAAGGAC
CTGAAGAAAGACTCTGGTAAAGGCTTCTACCATTGGATGAGGCCCTATGA
GAGGTTTCAGCCGAAGCCAATGAAACCGAGCAATGTTTTGCCTCCTAGAC
TACCAAAGGCGTTTTTATTGAGGTCTTGTATCAAATCTTCGCTAAAGCAG
CAGTGGAAGGAAAGTGAAAGGGCCAAGTTGAAGGGCGCGAAAGAGCTGCT
GTCGGCCATATTGCGGTACCGCCGGGTCATGGAGTCCGACAGCGAGACAA
TACTGCACGTGCCTATCAGGGATACGAGATCGGACGAGGAGAGGTGCACA
GACGACATCATTCAAGCTTTAGGACACAGGTGA
back to top

protein sequence of OSCA020774-RA

>OSCA020774-PA ID=OSCA020774-PA|Name=OSCA020774-RA|organism=Ostrinia scapulalis|type=polypeptide|length=1660bp
MGPKKGKDVVDENYWRTCIEEAPLDEETWKVKVVLIEAAGSDQDRIYLNK
FETFAAEEKRFVIKNICKTETTFMINQLGGEKKVKDDNLRVFEEGQAFLK
DKKDIPPDILALIIKHXILKMKDEYLFIKRQRLEVKEGMRRESTTMVNRA
EVRGTVSVKPPDPPEPEPPPKAKGKKGEPEPLPQTPEPSEGKKYNTQLRV
RGEEWRDKVYVDDFPTDGPNLYVAITGFVEPYLPGALVKIGIPLTAVVQI
RIDSSTTRVPSSLLRPSKRGQSQTEILTEKSXKFWDDLQQLRIHRDSADD
FKNTAFVVFAPPYWDSESLSGSPDKIYDELCYLMYDIQDLTRQHTHYLEN
MEIINIPMDFNDERYIKYYYQQIQDLPLECVTIYSLLDSVLHTVEKSHEI
DEKSSRTSLSTALTINQPRKSGDEDGKIAKAETLVRDVFSTLCKTESQKK
AYRLTYGDEYENHKDPIIIHYGDIAKYNTFHLGNINLDNIVWTTLFGMPI
NQLWQNQNRPQGEIEAKINFHINVLLTCFDREDVETAELNRLIHILACRK
LYNNRSSLKKKHLPSSTISEFKKVYLKRSVLAEPLPKCPSFXKSSSSTSP
SFPSMTKSENVSGASYSDDPEVCRIRFLFDCPDISELVSAAEISNEQPIN
HMIDDFEHFEDFSGVSAFQIMRDAFNSFNCVDYKYCEVTDSFILMFFNSH
DKDGIAREEWRCHIPTPLCLQDFFDFVLEEHYDWIQNEEKIYDENVVLKS
QSECKEIIDPFAIKSCVENTEVELELLMEGSLKFQELAVMEEASVEASET
KITSKKTTMSPSSTEVDSKSSRKPKSSAASTPKNLRQSFMAMGTDSNASI
EIPAKPFSGYDLGDRRVEVFGQNSTFFSKDGTQVISKYSLTIPMNLEYII
LNVVPGNGINEFWLHRALGEYVTPEILDICESFRITSKDQVMINVKKQTY
QVPIPMMSMSFIDSKPKESMYKPSTERYGDGIPQIFESKYFHSLFITWPN
GLITESVHLDNSPDISHIKQYFIDPMPHLDEEMRCISLNGEVIVFRPSGI
IEVLRPDGSFIKITKCEKRIVQTEPPEDMHSETSSDKSKKGKGKEKDKKE
KPSKASSKSSKNAIADDGSEIKPPEYELVIEEFETIETNGLRQKWVDEIP
TPIEKLXIRTATDYCLGEVFSRRMDGTNSLLNKDGVHVVTFPNNTRIITT
YFIEEEEVFPEWTDEEKEYFDLFDSDTVETDTLKSKASMSQKSYIGTYTY
SSVASSASKKIGEEEEETKEKERTDGYVSVQIILTIEHANFTTITLNKAD
NKISVDSPNKSKVVMDSENHYDIYLDSATSAKFDGQSLHVNFEACSECRS
NTTSTIKVKTDDMSSVTKMHQHWLRMKDSFCKKVIVNEEGHISIMDEPCS
TEVYTSEEVTNTEECHDSEQKPLDAKSXNSFVAHGKCREMYLAKTIRFFV
LRRYVCLQRVNFLRCSLVFRLTLRCCFSELSCSELVHRALLEQHKKACRW
QPWCSINQYDTFGDHRNLXSILTPIHLTETEKWLMDSKLADKPKYLTYKD
LKKDSGKGFYHWMRPYERFQPKPMKPSNVLPPRLPKAFLLRSCIKSSLKQ
QWKESERAKLKGAKELLSAILRYRRVMESDSETILHVPIRDTRSDEERCT
DDIIQALGHR
back to top

mRNA from alignment at newscf_11477:478..5966-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA020774-RA ID=OSCA020774-RA|Name=OSCA020774-RA|organism=Ostrinia scapulalis|type=mRNA|length=5489bp|location=Sequence derived from alignment at newscf_11477:478..5966- (Ostrinia scapulalis)
ATGGGTCCCAAGAAGGGTAAAGATGTCGTAGATGAAAACTATTGGCGTAC CTGTATAGAAGAAGCTCCACTAGATGAAGAGACTTGGAAAGTCAAGGTGG TTCTTATAGAAGCAGCTGGAAGTGACCAAGATCGCATTTATTTGAACAAG TTTGAAACTTTTGCCGCTGAAGAGAAGAGATTTGTAATAAAAAATATCTG CAAGACTGAAACGACCTTCATGATTAACCAGTTGGGTGGAGAGAAGAAAG TAAAAGATGACAATCTTCGCGTCTTCGAAGAAGGCCAGGCRTTTCTTAAA GACAAAAAGGATATACCCCCGGATATACTAGCACTGATAATTAAACATYT MATTTTAAAAATGAAAGATGAATATCTTTTTATAAAACGCCAAAGATTGG AAGTTAAGGAAGGAATGCGAAGAGAATCTACAACCATGGTTAATAGAGCA GAAGTTAGAGGAACTGTCAGCGTYAAGCCTCCAGATCCACCAGAACCCGA ACCGCCCCCAAAAGCTAAGGGTAAAAAGGGCGAACCAGAGCCATTACCTC AAACTCCAGAGCCATCCGAGGGAAAGAAATATAATACGCAGTTACGCGTT AGAGGAGAAGAATGGAGAGACAAAGTTTACGTTGATGATTTCCCTACAGA TGGTCCTAATCTTTATGTTGCTATAACTGGCTTTGTGGAACCTTACTTAC CTGGAGCACTTGTCAAAATTGGAATTCCGCTCACGGCAGTGGTTCAAATA CGGATCGATTCATCTACAACTCGAGTGCCTTCAAGCTTACTGAGACCCAG CAAAAGAGGACAAAGCCAAACAGAAATTTTAACTGAGAAATCTTTRAAGT TTTGGGATGATTTACAGCAGCTGAGAATTCACAGAGATTCAGCTGATGAT TTTAAGAACACTGCTTTTGTTGTTTTCGCACCRCCGTACTGGGATTCCGA GAGCTTATCTGGCAGTCCGGATAAAATTTATGACGAATTGTGTTACCTAA TGTACGATATTCAAGATTTAACGCGACAACATACGCATTATTTAGAAAAC ATGGAAATTATCAATATCCCCATGGACTTTAATGACGAGCGATATATCAA GTATTATTATCAACAAATACAAGATCTGCCTCTGGAATGCGTTACCATAT ATTCGCTTTTGGATAGTGTACTTCACACCGTTGAAAAAAGTCATGAAATT GATGAAAAAAGTAGCAGGACGTCACTGTCCACTGCTTTGACTATAAACCA ACCTCGAAAAAGTGGTGACGAGGATGGTAAAATAGCAAAGGCGGAAACCC TTGTTAGAGATGTTTTCAGTACATTATGTAAAACTGAATCTCAGAAAAAA GCTTACCGTCTCACATATGGCGATGAATATGAAAATCATAAAGATCCTAT AATAATACATTACGGAGATATAGCGAAGTATAACACCTTTCACCTGGGAA ATATCAATTTAGATAATATAGTTTGGACAACATTATTTGGAATGCCTATC AACCAATTGTGGCAGAATCAAAACAGACCCCAAGGCGAGATAGAGGCCAA AATAAATTTTCACATTAATGTACTTCTTACATGTTTTGATCGAGAAGACG TGGAAACAGCGGAGCTAAATAGACTAATCCACATATTAGCCTGTCGAAAA TTATACAATAATAGAAGTTCTCTTAAAAAAAAGCACTTGCCATCTTCAAC AATATCAGAATTTAAAAAAGTATATTTAAAACGCAGTGTTTTAGCTGAAC CACTACCTAAATGTCCCTCATTTATKAAGAGTTCTAGTTCAACATCTCCT TCATTTCCCTCAATGACAAAAAGTGAAAATGTATCAGGCGCTTCCTACAG CGATGACCCCGAAGTTTGTCGAATAAGATTTCTTTTTGACTGTCCTGACA TAAGCGAACTGGTATCTGCCGCCGAAATCTCAAATGAGCAGCCAATCAAT CACATGATTGATGATTTTGAACATTTTGAAGATTTCTCTGGAGTTAGTGC CTTTCAAATTATGCGAGATGCATTTAACAGCTTTAATTGTGTTGATTACA AGTACTGTGAAGTTACTGACAGTTTCATATTAATGTTTTTTAATAGTCAC GACAAAGACGGCATTGCCCGAGAAGAGTGGAGGTGTCATATTCCTACTCC ATTGTGTTTGCAAGATTTTTTCGACTTTGTCCTTGAAGAGCATTATGACT GGATTCAAAATGAAGAAAAAATTTATGACGAAAATGTTGTCTTGAAATCA CAATCTGAATGCAAAGAAATTATTGATCCTTTTGCAATTAAATCGTGTGT AGAAAATACAGAAGTGGAATTAGAACTTCTGATGGAAGGTTCTCTAAAAT TTCAAGAACTTGCAGTTATGGAAGAAGCTAGTGTTGAAGCGTCGGAAACC AAAATTACTTCTAAAAAAACTACAATGTCACCGAGCTCAACTGAAGTAGA TTCTAAGAGCAGTAGAAAACCAAAATCCTCTGCGGCATCCACACCAAAGA ATTTGAGGCAATCATTTATGGCAATGGGAACTGATTCAAATGCTTCAATT GAAATACCTGCTAAACCTTTTTCTGGGTATGATTTGGGCGATAGAAGAGT TGAAGTTTTTGGACAAAACTCGACGTTCTTCTCCAAAGATGGAACACAAG TGATAAGTAAATATTCGTTAACGATACCAATGAATTTGGAATACATCATT TTGAATGTTGTCCCTGGAAATGGTATAAATGAGTTTTGGTTGCATAGAGC TTTGGGTGAATATGTTACTCCCGAAATATTAGATATCTGCGAATCATTCA GAATAACTAGCAAAGATCAAGTTATGATTAATGTTAAAAAGCAGACATAC CAAGTACCAATACCTATGATGTCAATGTCTTTCATAGACTCAAAACCAAA AGAAAGCATGTATAAGCCATCTACTGAAAGATATGGTGATGGAATTCCTC AAATATTTGAGTCAAAATATTTTCATTCTCTTTTCATTACTTGGCCTAAT GGATTAATAACTGAAAGTGTTCATCTGGACAATTCACCCGATATATCACA CATCAAACAGTATTTTATAGATCCAATGCCACACCTTGACGAAGAAATGC GTTGTATAAGTTTAAATGGTGAGGTAATAGTGTTTCGGCCATCTGGTATT ATAGAAGTGTTGCGTCCAGATGGATCTTTTATTAAAATAACCAAATGCGA AAAAAGGATTGTCCAAACAGAGCCACCTGAAGATATGCACAGCGAAACCA GTTCTGACAAAAGCAAAAAAGGAAAAGGTAAAGAGAAAGATAAAAAGGAA AAGCCCAGCAAAGCTTCTTCTAAATCATCAAAAAATGCTATCGCCGACGA CGGTTCGGAAATAAAACCGCCTGAATATGAATTAGTCATAGAAGAATTTG AAACTATTGAAACAAATGGATTGAGGCAAAAATGGGTAGATGAAATCCCA ACACCAATTGAGAAGCTATTRATAAGAACAGCCACGGACTATTGTTTAGG AGAAGTTTTTTCTAGACGAATGGATGGTACAAATTCTTTGCTTAATAAAG ATGGTGTTCATGTAGTGACTTTTCCAAACAATACTAGAATTATTACTACC TATTTTATTGAAGAAGAGGAAGTTTTCCCTGAATGGACAGACGAAGAAAA AGAATATTTTGATTTGTTCGATTCTGATACAGTAGAGACGGATACTCTTA AATCTAAAGCGTCAATGTCTCAAAAAAGTTACATTGGAACTTACACATAC AGCAGCGTAGCTAGTTCAGCTTCCAAAAAAATTGGAGAAGAAGAGGAAGA AACCAAAGAAAAAGAAAGAACTGACGGTTACGTATCTGTACAAATAATTT TAACTATAGAACATGCCAATTTTACTACAATTACATTAAATAAAGCGGAT AACAAAATATCTGTAGATTCTCCAAACAAAAGTAAAGTAGTAATGGATAG TGAAAATCACTATGATATATACCTTGACAGTGCAACATCAGCTAAGTTCG ATGGCCAGTCATTACATGTTAATTTCGAAGCTTGTTCGGAATGCCGGTCT AATACCACATCTACCATTAAAGTAAAAACTGATGATATGAGCAGTGTAAC AAAAATGCACCAGCATTGGTTGAGAATGAAAGATTCGTTTTGTAAAAAAG TTATTGTAAATGAAGAGGGCCATATTTCCATCATGGATGAACCGTGTTCT ACTGAAGTGTACACCAGCGAAGAAGTTACAAATACAGAAGAATGTCACGA TAGTGAGCAGAAGCCATTAGATGCCAAGTCAGAKAATTCTTTTGTCGCCC ATGGTAAATGTAGAGAGATGTACTTGGCAAAGACAATTAGATTTTTTGTT CTTCGACGGTACGTATGCCTACAGAGAGTAAATTTTTTAAGATGCAGTTT AGTATTTAGGCTTACGCTAAGATGTTGTTTCAGTGAGTTATCATGTTCAG AGCTCGTACATCGAGCGTTACTTGAGCAGCACAAGAAAGCTTGTCGCTGG CAGCCCTGGTGCTCTATCAATCAGTACGACACATTTGGGGATCATCGCAA CCTTYTGTCCATTCTTACTCCTATCCACCTGACGGAGACTGAGGTTGATA TAATTTACTATTGTATTTGTAGATGCAGGTTATTGCATGTTATGTAGATA TTTGATGTAGCTCAGCCTGATGGTTGCATTCTTCCACTATTATAATCATA AGTAGTGATTTTTGCACTAGTGAGGTTATGCAGATAGGTTCAAAAAATGT ATAAAAACTAATTAAACCGTTAATTTAAAAACACATTTCTATCGCTRACT AGAAATGGCTGATGGATTCGAAGCTGGCAGATAAACCGAAGTATCTTACC TACAAGGACCTGAAGAAAGACTCTGGTAAAGGCTTCTACCATTGGATGAG GCCCTATGAGAGGTTTCAGCCGAAGCCAATGAAACCGAGCAATGTTTTGC CTCCTAGACTACCAAAGGCGTTTTTATTGAGGTCTTGTATCAAATCTTCG CTAAGTAATATTTTATATCGTAGAAAATTAGTAGAAGCATAGAGTAGAAG TTAATGAAACCCCCTGATGTCCCCCTTAATCTAAAAATATTACGCTTTAG AACTTTGTTTTCAATCTAAAGTTTAATTTATGCATATTATCTGACGGTAA AGTAAAATTTTAACTGCGTGTTGTCTTACCCATTTAAATTTTAATAACTT ATTCAATTTTGAATTGCTAAACAAAACCTTATCTAAGTACTCAATCTGAG ACACCTGCTGGTAGGTGTTTATTTTCTTTATTTACGCGAGCAGAACTCTA GAGCAGCAGTGGAAGGAAAGTGAAAGGGCCAAGTTGAAGGGCGCGAAAGA GCTGCTGTCGGCCATATTGCGGTACCGCCGGGTCATGGAGTCCGACAGCG AGACAATACTGCACGTGCCTATCAGGGATACGAGATCGGACGAGGAGAGG TGCACAGACGACATCATTCAAGCTTTAGGACACAGGTGA
back to top

Coding sequence (CDS) from alignment at newscf_11477:478..5966-

>OSCA020774-RA ID=OSCA020774-RA|Name=OSCA020774-RA|organism=Ostrinia scapulalis|type=CDS|length=4983bp|location=Sequence derived from alignment at newscf_11477:478..5966- (Ostrinia scapulalis)
ATGGGTCCCAAGAAGGGTAAAGATGTCGTAGATGAAAACTATTGGCGTAC
CTGTATAGAAGAAGCTCCACTAGATGAAGAGACTTGGAAAGTCAAGGTGG
TTCTTATAGAAGCAGCTGGAAGTGACCAAGATCGCATTTATTTGAACAAG
TTTGAAACTTTTGCCGCTGAAGAGAAGAGATTTGTAATAAAAAATATCTG
CAAGACTGAAACGACCTTCATGATTAACCAGTTGGGTGGAGAGAAGAAAG
TAAAAGATGACAATCTTCGCGTCTTCGAAGAAGGCCAGGCRTTTCTTAAA
GACAAAAAGGATATACCCCCGGATATACTAGCACTGATAATTAAACATYT
MATTTTAAAAATGAAAGATGAATATCTTTTTATAAAACGCCAAAGATTGG
AAGTTAAGGAAGGAATGCGAAGAGAATCTACAACCATGGTTAATAGAGCA
GAAGTTAGAGGAACTGTCAGCGTYAAGCCTCCAGATCCACCAGAACCCGA
ACCGCCCCCAAAAGCTAAGGGTAAAAAGGGCGAACCAGAGCCATTACCTC
AAACTCCAGAGCCATCCGAGGGAAAGAAATATAATACGCAGTTACGCGTT
AGAGGAGAAGAATGGAGAGACAAAGTTTACGTTGATGATTTCCCTACAGA
TGGTCCTAATCTTTATGTTGCTATAACTGGCTTTGTGGAACCTTACTTAC
CTGGAGCACTTGTCAAAATTGGAATTCCGCTCACGGCAGTGGTTCAAATA
CGGATCGATTCATCTACAACTCGAGTGCCTTCAAGCTTACTGAGACCCAG
CAAAAGAGGACAAAGCCAAACAGAAATTTTAACTGAGAAATCTTTRAAGT
TTTGGGATGATTTACAGCAGCTGAGAATTCACAGAGATTCAGCTGATGAT
TTTAAGAACACTGCTTTTGTTGTTTTCGCACCRCCGTACTGGGATTCCGA
GAGCTTATCTGGCAGTCCGGATAAAATTTATGACGAATTGTGTTACCTAA
TGTACGATATTCAAGATTTAACGCGACAACATACGCATTATTTAGAAAAC
ATGGAAATTATCAATATCCCCATGGACTTTAATGACGAGCGATATATCAA
GTATTATTATCAACAAATACAAGATCTGCCTCTGGAATGCGTTACCATAT
ATTCGCTTTTGGATAGTGTACTTCACACCGTTGAAAAAAGTCATGAAATT
GATGAAAAAAGTAGCAGGACGTCACTGTCCACTGCTTTGACTATAAACCA
ACCTCGAAAAAGTGGTGACGAGGATGGTAAAATAGCAAAGGCGGAAACCC
TTGTTAGAGATGTTTTCAGTACATTATGTAAAACTGAATCTCAGAAAAAA
GCTTACCGTCTCACATATGGCGATGAATATGAAAATCATAAAGATCCTAT
AATAATACATTACGGAGATATAGCGAAGTATAACACCTTTCACCTGGGAA
ATATCAATTTAGATAATATAGTTTGGACAACATTATTTGGAATGCCTATC
AACCAATTGTGGCAGAATCAAAACAGACCCCAAGGCGAGATAGAGGCCAA
AATAAATTTTCACATTAATGTACTTCTTACATGTTTTGATCGAGAAGACG
TGGAAACAGCGGAGCTAAATAGACTAATCCACATATTAGCCTGTCGAAAA
TTATACAATAATAGAAGTTCTCTTAAAAAAAAGCACTTGCCATCTTCAAC
AATATCAGAATTTAAAAAAGTATATTTAAAACGCAGTGTTTTAGCTGAAC
CACTACCTAAATGTCCCTCATTTATKAAGAGTTCTAGTTCAACATCTCCT
TCATTTCCCTCAATGACAAAAAGTGAAAATGTATCAGGCGCTTCCTACAG
CGATGACCCCGAAGTTTGTCGAATAAGATTTCTTTTTGACTGTCCTGACA
TAAGCGAACTGGTATCTGCCGCCGAAATCTCAAATGAGCAGCCAATCAAT
CACATGATTGATGATTTTGAACATTTTGAAGATTTCTCTGGAGTTAGTGC
CTTTCAAATTATGCGAGATGCATTTAACAGCTTTAATTGTGTTGATTACA
AGTACTGTGAAGTTACTGACAGTTTCATATTAATGTTTTTTAATAGTCAC
GACAAAGACGGCATTGCCCGAGAAGAGTGGAGGTGTCATATTCCTACTCC
ATTGTGTTTGCAAGATTTTTTCGACTTTGTCCTTGAAGAGCATTATGACT
GGATTCAAAATGAAGAAAAAATTTATGACGAAAATGTTGTCTTGAAATCA
CAATCTGAATGCAAAGAAATTATTGATCCTTTTGCAATTAAATCGTGTGT
AGAAAATACAGAAGTGGAATTAGAACTTCTGATGGAAGGTTCTCTAAAAT
TTCAAGAACTTGCAGTTATGGAAGAAGCTAGTGTTGAAGCGTCGGAAACC
AAAATTACTTCTAAAAAAACTACAATGTCACCGAGCTCAACTGAAGTAGA
TTCTAAGAGCAGTAGAAAACCAAAATCCTCTGCGGCATCCACACCAAAGA
ATTTGAGGCAATCATTTATGGCAATGGGAACTGATTCAAATGCTTCAATT
GAAATACCTGCTAAACCTTTTTCTGGGTATGATTTGGGCGATAGAAGAGT
TGAAGTTTTTGGACAAAACTCGACGTTCTTCTCCAAAGATGGAACACAAG
TGATAAGTAAATATTCGTTAACGATACCAATGAATTTGGAATACATCATT
TTGAATGTTGTCCCTGGAAATGGTATAAATGAGTTTTGGTTGCATAGAGC
TTTGGGTGAATATGTTACTCCCGAAATATTAGATATCTGCGAATCATTCA
GAATAACTAGCAAAGATCAAGTTATGATTAATGTTAAAAAGCAGACATAC
CAAGTACCAATACCTATGATGTCAATGTCTTTCATAGACTCAAAACCAAA
AGAAAGCATGTATAAGCCATCTACTGAAAGATATGGTGATGGAATTCCTC
AAATATTTGAGTCAAAATATTTTCATTCTCTTTTCATTACTTGGCCTAAT
GGATTAATAACTGAAAGTGTTCATCTGGACAATTCACCCGATATATCACA
CATCAAACAGTATTTTATAGATCCAATGCCACACCTTGACGAAGAAATGC
GTTGTATAAGTTTAAATGGTGAGGTAATAGTGTTTCGGCCATCTGGTATT
ATAGAAGTGTTGCGTCCAGATGGATCTTTTATTAAAATAACCAAATGCGA
AAAAAGGATTGTCCAAACAGAGCCACCTGAAGATATGCACAGCGAAACCA
GTTCTGACAAAAGCAAAAAAGGAAAAGGTAAAGAGAAAGATAAAAAGGAA
AAGCCCAGCAAAGCTTCTTCTAAATCATCAAAAAATGCTATCGCCGACGA
CGGTTCGGAAATAAAACCGCCTGAATATGAATTAGTCATAGAAGAATTTG
AAACTATTGAAACAAATGGATTGAGGCAAAAATGGGTAGATGAAATCCCA
ACACCAATTGAGAAGCTATTRATAAGAACAGCCACGGACTATTGTTTAGG
AGAAGTTTTTTCTAGACGAATGGATGGTACAAATTCTTTGCTTAATAAAG
ATGGTGTTCATGTAGTGACTTTTCCAAACAATACTAGAATTATTACTACC
TATTTTATTGAAGAAGAGGAAGTTTTCCCTGAATGGACAGACGAAGAAAA
AGAATATTTTGATTTGTTCGATTCTGATACAGTAGAGACGGATACTCTTA
AATCTAAAGCGTCAATGTCTCAAAAAAGTTACATTGGAACTTACACATAC
AGCAGCGTAGCTAGTTCAGCTTCCAAAAAAATTGGAGAAGAAGAGGAAGA
AACCAAAGAAAAAGAAAGAACTGACGGTTACGTATCTGTACAAATAATTT
TAACTATAGAACATGCCAATTTTACTACAATTACATTAAATAAAGCGGAT
AACAAAATATCTGTAGATTCTCCAAACAAAAGTAAAGTAGTAATGGATAG
TGAAAATCACTATGATATATACCTTGACAGTGCAACATCAGCTAAGTTCG
ATGGCCAGTCATTACATGTTAATTTCGAAGCTTGTTCGGAATGCCGGTCT
AATACCACATCTACCATTAAAGTAAAAACTGATGATATGAGCAGTGTAAC
AAAAATGCACCAGCATTGGTTGAGAATGAAAGATTCGTTTTGTAAAAAAG
TTATTGTAAATGAAGAGGGCCATATTTCCATCATGGATGAACCGTGTTCT
ACTGAAGTGTACACCAGCGAAGAAGTTACAAATACAGAAGAATGTCACGA
TAGTGAGCAGAAGCCATTAGATGCCAAGTCAGAKAATTCTTTTGTCGCCC
ATGGTAAATGTAGAGAGATGTACTTGGCAAAGACAATTAGATTTTTTGTT
CTTCGACGGTACGTATGCCTACAGAGAGTAAATTTTTTAAGATGCAGTTT
AGTATTTAGGCTTACGCTAAGATGTTGTTTCAGTGAGTTATCATGTTCAG
AGCTCGTACATCGAGCGTTACTTGAGCAGCACAAGAAAGCTTGTCGCTGG
CAGCCCTGGTGCTCTATCAATCAGTACGACACATTTGGGGATCATCGCAA
CCTTYTGTCCATTCTTACTCCTATCCACCTGACGGAGACTGAGAAATGGC
TGATGGATTCGAAGCTGGCAGATAAACCGAAGTATCTTACCTACAAGGAC
CTGAAGAAAGACTCTGGTAAAGGCTTCTACCATTGGATGAGGCCCTATGA
GAGGTTTCAGCCGAAGCCAATGAAACCGAGCAATGTTTTGCCTCCTAGAC
TACCAAAGGCGTTTTTATTGAGGTCTTGTATCAAATCTTCGCTAAAGCAG
CAGTGGAAGGAAAGTGAAAGGGCCAAGTTGAAGGGCGCGAAAGAGCTGCT
GTCGGCCATATTGCGGTACCGCCGGGTCATGGAGTCCGACAGCGAGACAA
TACTGCACGTGCCTATCAGGGATACGAGATCGGACGAGGAGAGGTGCACA
GACGACATCATTCAAGCTTTAGGACACAGGTGA
back to top
Synonyms
The feature 'OSCA020774-RA' has the following synonyms
Synonym
maker-newscf_11477-snap-gene-0.3-mRNA-1