OSCA023331-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA023331-RA
Unique NameOSCA023331-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length210
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_13161contignewscf_13161:3531..3833 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.77
QI0|0|0|1|1|1|2|0|69
AED0.39
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA023331OSCA023331Ostrinia scapulalisgenenewscf_13161 3531..3833 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023331-RAOSCA023331-PAOstrinia scapulalispolypeptidenewscf_13161 3531..3833 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023331-RA:cdsOSCA023331-RA:cdsOstrinia scapulalisCDSnewscf_13161 3531..3620 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023331-RA:exon:2522OSCA023331-RA:exon:2522Ostrinia scapulalisexonnewscf_13161 3531..3620 -
OSCA023331-RA:exon:2523OSCA023331-RA:exon:2523Ostrinia scapulalisexonnewscf_13161 3714..3833 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA023331-RA ID=OSCA023331-RA|Name=OSCA023331-RA|organism=Ostrinia scapulalis|type=mRNA|length=210bp
ATGGCCAGGGCACTGTACGCAGAACTGACGGCCGATGGGGCAGGTTCTGG
AGTGGAGGCCGCGTACCGGAAAACGCAGCGTGGTACGTCCACCCATAAGG
TGGACCGCGACATCATAAAGGTCTCAGCCATAGCTGAGATGATGATGATG
ATGATGATGATGATGATGATGATGATGATGATGATGATGATGACTGAATT
TCACAGATGA
back to top

spliced messenger RNA

>OSCA023331-RA ID=OSCA023331-RA|Name=OSCA023331-RA|organism=Ostrinia scapulalis|type=mRNA|length=210bp|location=Sequence derived from alignment at newscf_13161:3531..3833- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGCCAGGGCACTGTACGCAGAACTGACGGCCGATGGGGCAGGTTCTGG
AGTGGAGGCCGCGTACCGGAAAACGCAGCGTGGTACGTCCACCCATAAGG
TGGACCGCGACATCATAAAGGTCTCAGCCATAGCTGAGATGATGATGATG
ATGATGATGATGATGATGATGATGATGATGATGATGATGATGACTGAATT
TCACAGATGA
back to top

protein sequence of OSCA023331-RA

>OSCA023331-PA ID=OSCA023331-PA|Name=OSCA023331-RA|organism=Ostrinia scapulalis|type=polypeptide|length=69bp
MARALYAELTADGAGSGVEAAYRKTQRGTSTHKVDRDIIKVSAIAEMMMM
MMMMMMMMMMMMMMTEFHR
back to top

mRNA from alignment at newscf_13161:3531..3833-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA023331-RA ID=OSCA023331-RA|Name=OSCA023331-RA|organism=Ostrinia scapulalis|type=mRNA|length=303bp|location=Sequence derived from alignment at newscf_13161:3531..3833- (Ostrinia scapulalis)
ATGGCCAGGGCACTGTACGCAGAACTGACGGCCGATGGGGCAGGTTCTGG AGTGGAGGCCGCGTACCGGAAAACGCAGCGTGGTACGTCCACCCATAAGG TGGACCGCGACATCATAAAGGTAGGAGGAAGGCGCTGAATGCAGGCCGCT ACCAACCGGGCAGCATGGAAAGCATTGGGGGAGGCCTATGTTCAGCAGTG GACGTCCCATTAGGTCTCAGCCATAGCTGAGATGATGATGATGATGATGA TGATGATGATGATGATGATGATGATGATGATGATGACTGAATTTCACAGA TGA
back to top

Coding sequence (CDS) from alignment at newscf_13161:3531..3833-

>OSCA023331-RA ID=OSCA023331-RA|Name=OSCA023331-RA|organism=Ostrinia scapulalis|type=CDS|length=210bp|location=Sequence derived from alignment at newscf_13161:3531..3833- (Ostrinia scapulalis)
ATGGCCAGGGCACTGTACGCAGAACTGACGGCCGATGGGGCAGGTTCTGG
AGTGGAGGCCGCGTACCGGAAAACGCAGCGTGGTACGTCCACCCATAAGG
TGGACCGCGACATCATAAAGGTCTCAGCCATAGCTGAGATGATGATGATG
ATGATGATGATGATGATGATGATGATGATGATGATGATGATGACTGAATT
TCACAGATGA
back to top
Synonyms
The feature 'OSCA023331-RA' has the following synonyms
Synonym
maker-newscf_13161-augustus-gene-0.2-mRNA-1