OSCA023813-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA023813-RA
Unique NameOSCA023813-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length303
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25828contignewscf_25828:173..1183 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.06
QI0|0|0|1|1|1|2|0|100
AED0.06
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA023813OSCA023813Ostrinia scapulalisgenenewscf_25828 173..1183 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023813-RAOSCA023813-PAOstrinia scapulalispolypeptidenewscf_25828 173..1183 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023813-RA:exon:4471OSCA023813-RA:exon:4471Ostrinia scapulalisexonnewscf_25828 173..327 +
OSCA023813-RA:exon:4472OSCA023813-RA:exon:4472Ostrinia scapulalisexonnewscf_25828 1036..1183 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023813-RA:cdsOSCA023813-RA:cdsOstrinia scapulalisCDSnewscf_25828 1036..1183 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA023813-RA ID=OSCA023813-RA|Name=OSCA023813-RA|organism=Ostrinia scapulalis|type=mRNA|length=303bp
GTTCTAAAATCCCGCAGGAACGCTCTCCGGCTGGTGCGTCCAGGTGGCGC
AGTAGTATACTCCACATGCTCGCTAAGTCCCGTCCAAAACGACGGCGTTG
TGCACGCGGCGTTGAAACGCGCCTTTGAAGAATACGGCGTGCTGGCTGCT
GTCAAGGACCTAACAATCCCAATGTCAGCACTTAGCAGTACGTTGTTGCT
AGCTACGGGCGACATCGCGCCGCGCTATGGGCAACTGGTGCTACCGTCGG
TGTCTGCCAACTTCGGCCCTTCGTACCTCGCCAGGCTAGTCAGAATTAAG
TAA
back to top

spliced messenger RNA

>OSCA023813-RA ID=OSCA023813-RA|Name=OSCA023813-RA|organism=Ostrinia scapulalis|type=mRNA|length=303bp|location=Sequence derived from alignment at newscf_25828:173..1183+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
GTTCTAAAATCCCGCAGGAACGCTCTCCGGCTGGTGCGTCCAGGTGGCGC
AGTAGTATACTCCACATGCTCGCTAAGTCCCGTCCAAAACGACGGCGTTG
TGCACGCGGCGTTGAAACGCGCCTTTGAAGAATACGGCGTGCTGGCTGCT
GTCAAGGACCTAACAATCCCAATGTCAGCACTTAGCAGTACGTTGTTGCT
AGCTACGGGCGACATCGCGCCGCGCTATGGGCAACTGGTGCTACCGTCGG
TGTCTGCCAACTTCGGCCCTTCGTACCTCGCCAGGCTAGTCAGAATTAAG
TAA
back to top

protein sequence of OSCA023813-RA

>OSCA023813-PA ID=OSCA023813-PA|Name=OSCA023813-RA|organism=Ostrinia scapulalis|type=polypeptide|length=100bp
VLKSRRNALRLVRPGGAVVYSTCSLSPVQNDGVVHAALKRAFEEYGVLAA
VKDLTIPMSALSSTLLLATGDIAPRYGQLVLPSVSANFGPSYLARLVRIK
back to top

mRNA from alignment at newscf_25828:173..1183+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA023813-RA ID=OSCA023813-RA|Name=OSCA023813-RA|organism=Ostrinia scapulalis|type=mRNA|length=1011bp|location=Sequence derived from alignment at newscf_25828:173..1183+ (Ostrinia scapulalis)
GTTCTAAAATCCCGCAGGAACGCTCTCCGGCTGGTGCGTCCAGGTGGCGC AGTAGTATACTCCACATGCTCGCTAAGTCCCGTCCAAAACGACGGCGTTG TGCACGCGGCGTTGAAACGCGCCTTTGAAGAATACGGCGTGCTGGCTGCT GTCAAGTGAGTAACATCTACAAAACTTTTAAAGATTAAACGACGTGTTCC TCTTTTGTCTATGGTCAGGTCTAGGATAGCGGTCCACAGGGTTAACTGAG AAAAGAAGCCAAAACAAAAAAAATGTCTGATGGTCAATCCTCAACATCGA AAGAGTTTTAGAGAAATGTTTTTGTAACATTTTCATTCAATCCGTTGTTG CCTAGTSTTTTTAAAAAAGTATCACATCATCATCAACAGCCCTTTACAGT CCATTGCTGGACTATGAGCCTCCTCCACTATAGTGGAGGGTTTGCCATAA TCCCCACGTTTGGCAGGCGGGTTAGAGATCGCAGTTTAAAAGATTGATGT ATTTCAGAGAGCGCATCTGCCCGTTCTTTGTTTGATGTGTAGTCCCCAAG TCGCCTCTTACGACACCCGTGGGAAGAGTAGGGGTTGGTGACAAATGTAT TCTACTCTGCAGTCACCACACGGCTTGAAAAAGTATCTACTTACGTTTTA TTTCATAACTAGCGGCCGCCCGCGAGTTAGGGGTTAAATTTTGCAAAATC CCGTCTTAATGAACACCTACGTTCTAAAAGGAACCCCCATGCAAAAACAT TGAGATTTCTAGCACTTGTAGTTTCTGAGATTTCGTGATGAGTAAGTCAG TGAATCAGTGATCTTTCGCTTTTATAGTTATAGATTTTAAATTCTTTTAC GCTTGCTTTTCAGGGACCTAACAATCCCAATGTCAGCACTTAGCAGTACG TTGTTGCTAGCTACGGGCGACATCGCGCCGCGCTATGGGCAACTGGTGCT ACCGTCGGTGTCTGCCAACTTCGGCCCTTCGTACCTCGCCAGGCTAGTCA GAATTAAGTAA
back to top

Coding sequence (CDS) from alignment at newscf_25828:173..1183+

>OSCA023813-RA ID=OSCA023813-RA|Name=OSCA023813-RA|organism=Ostrinia scapulalis|type=CDS|length=303bp|location=Sequence derived from alignment at newscf_25828:173..1183+ (Ostrinia scapulalis)
GTTCTAAAATCCCGCAGGAACGCTCTCCGGCTGGTGCGTCCAGGTGGCGC
AGTAGTATACTCCACATGCTCGCTAAGTCCCGTCCAAAACGACGGCGTTG
TGCACGCGGCGTTGAAACGCGCCTTTGAAGAATACGGCGTGCTGGCTGCT
GTCAAGGACCTAACAATCCCAATGTCAGCACTTAGCAGTACGTTGTTGCT
AGCTACGGGCGACATCGCGCCGCGCTATGGGCAACTGGTGCTACCGTCGG
TGTCTGCCAACTTCGGCCCTTCGTACCTCGCCAGGCTAGTCAGAATTAAG
TAA
back to top
Synonyms
The feature 'OSCA023813-RA' has the following synonyms
Synonym
maker-newscf_25828-snap-gene-0.3-mRNA-1