OSCA023841-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA023841-RA
Unique NameOSCA023841-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length219
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_18660contignewscf_18660:3068..4466 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.20
QI0|0|0|0.5|1|1|2|0|72
AED0.20
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA023841OSCA023841Ostrinia scapulalisgenenewscf_18660 3068..4466 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023841-RAOSCA023841-PAOstrinia scapulalispolypeptidenewscf_18660 3068..4466 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023841-RA:exon:3803OSCA023841-RA:exon:3803Ostrinia scapulalisexonnewscf_18660 3068..3234 +
OSCA023841-RA:exon:3804OSCA023841-RA:exon:3804Ostrinia scapulalisexonnewscf_18660 4415..4466 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA023841-RA:cdsOSCA023841-RA:cdsOstrinia scapulalisCDSnewscf_18660 4415..4466 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA023841-RA ID=OSCA023841-RA|Name=OSCA023841-RA|organism=Ostrinia scapulalis|type=mRNA|length=219bp
GCACACCCCAAATATGACTACTCATACTCCGTGTCGGACCCTCACACCGG
AGACCACAAGACCCAGCACGAGGCCAGAGACGGCGACGTGGTGAAGGGCG
AGTACTCCCTGCTGCAGCCTGATGGCTCCTTCCGCAAGGTCACCTACACC
GCTGATGATCACAATGGATTCAACGCGGTAGTCCACAACACCGCGCCCCA
GCACCCCGAGTACCACTAA
back to top

spliced messenger RNA

>OSCA023841-RA ID=OSCA023841-RA|Name=OSCA023841-RA|organism=Ostrinia scapulalis|type=mRNA|length=219bp|location=Sequence derived from alignment at newscf_18660:3068..4466+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
GCACACCCCAAATATGACTACTCATACTCCGTGTCGGACCCTCACACCGG
AGACCACAAGACCCAGCACGAGGCCAGAGACGGCGACGTGGTGAAGGGCG
AGTACTCCCTGCTGCAGCCTGATGGCTCCTTCCGCAAGGTCACCTACACC
GCTGATGATCACAATGGATTCAACGCGGTAGTCCACAACACCGCGCCCCA
GCACCCCGAGTACCACTAA
back to top

protein sequence of OSCA023841-RA

>OSCA023841-PA ID=OSCA023841-PA|Name=OSCA023841-RA|organism=Ostrinia scapulalis|type=polypeptide|length=72bp
AHPKYDYSYSVSDPHTGDHKTQHEARDGDVVKGEYSLLQPDGSFRKVTYT
ADDHNGFNAVVHNTAPQHPEYH
back to top

mRNA from alignment at newscf_18660:3068..4466+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA023841-RA ID=OSCA023841-RA|Name=OSCA023841-RA|organism=Ostrinia scapulalis|type=mRNA|length=1399bp|location=Sequence derived from alignment at newscf_18660:3068..4466+ (Ostrinia scapulalis)
GCACACCCCAAATATGACTACTCATACTCCGTGTCGGACCCTCACACCGG AGACCACAAGACCCAGCACGAGGCCAGAGACGGCGACGTGGTGAAGGGCG AGTACTCCCTGCTGCAGCCTGATGGCTCCTTCCGCAAGGTCACCTACACC GCTGATGATCACAATGGGTAAGCAAGTCATCCCTATATGCAACTTTAAGA CGACTAGGTCAGTAACCCTGCTCTTCGATCTTTTGTTTTCTTCTAATGCG AAGAACTTAACCACTATGCAAGTTATCTCTGTTCCTACCACATCCACTAA CAGTCACTCTCAATTCTTGTACACAAATATAACAGCTTAAAATGACGTCT TGTACTTAATCTGATATTGCTGAGCTTCGTGGAATTGTTAAACGTAAAAT TATTAGTTACCTACTCATGTTAGAAATTTAAACATTGTGAAGAGCAGCTT TATCCTAGGACAAGTTTTTAAAAAACTTAAATGGATAAGGCTAATTTGTA ATGACAATGTAACATGTGTTTCATAATAAAATATTTGTATTTATTTGTAT TGTATTTGTATTGTTTGATGCAGATTTTCCCACATGTGATTGTAGAAATA ATATGATGGATGCAGGTCTTGCCATGCAATTATTAGATGTATTTAACAGA AATGTAGGTATATGGCTTTTTTAAATGGCACAGTTGCACTTGATCATTGT GAACCTTTAATCGTGACATTTTGAATGAATAGAATTCGATGTGTGCGTAT TGAATGGTAGAGCAAATGTAAAGTTCAGCACATTATCGCATTGTGCTTCC AATGTGACCTATATCGTATGCATTATGTCTCATATCCACGTTCAAAGATT TAGTTGAATGATTTAATCGAGTGACTGGCGCTCGTAACTATTAACCCCAG AAGCAAATGCCATACGCGAACATTTACGTTGGGTCACGAATGTTTATACT ATTTTACTAACATACTGAATGTATTGTGTGGAGTGTAGTGTCCGTACTCT TCCCTTGGATATGGTAAGAGAAATATGCGAACATGACTAGCGTGCAAGTG TGCTAAATAAATACTCTATTTGCCTCTAGTAGATCAGAGGATCTGACCTG CAGTGAAGACTAACGCCCGTATTCACAAATATGCATGCTTAAGTAAAGCA GCAAATCGAATGCACAGCGTTGATTCTTCGAGCTCTGTGATTGGTTTGTG TGTGACCCTCTGCGTTCACGCGCACTGTAAGACCTCATAGTAGGAYGTTY RTTAATATGGGCGTAAAGGACCTTTAGATAAATAGTAAGAATGTAATGAA AATGGATAGTAAGGAAATTAACTGAATATAATGTTTCTTGTTCACAGATT CAACGCGGTAGTCCACAACACCGCGCCCCAGCACCCCGAGTACCACTAA
back to top

Coding sequence (CDS) from alignment at newscf_18660:3068..4466+

>OSCA023841-RA ID=OSCA023841-RA|Name=OSCA023841-RA|organism=Ostrinia scapulalis|type=CDS|length=219bp|location=Sequence derived from alignment at newscf_18660:3068..4466+ (Ostrinia scapulalis)
GCACACCCCAAATATGACTACTCATACTCCGTGTCGGACCCTCACACCGG
AGACCACAAGACCCAGCACGAGGCCAGAGACGGCGACGTGGTGAAGGGCG
AGTACTCCCTGCTGCAGCCTGATGGCTCCTTCCGCAAGGTCACCTACACC
GCTGATGATCACAATGGATTCAACGCGGTAGTCCACAACACCGCGCCCCA
GCACCCCGAGTACCACTAA
back to top
Synonyms
The feature 'OSCA023841-RA' has the following synonyms
Synonym
maker-newscf_18660-snap-gene-0.3-mRNA-1