OSCA025101-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA025101-RA
Unique NameOSCA025101-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length219
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_19912contignewscf_19912:2941..3159 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.16
QI0|-1|0|1|-1|1|1|0|72
AED0.16
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025101OSCA025101Ostrinia scapulalisgenenewscf_19912 2941..3159 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025101-RAOSCA025101-PAOstrinia scapulalispolypeptidenewscf_19912 2941..3159 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025101-RA:cdsOSCA025101-RA:cdsOstrinia scapulalisCDSnewscf_19912 2941..3159 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025101-RA:exon:4443OSCA025101-RA:exon:4443Ostrinia scapulalisexonnewscf_19912 2941..3159 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA025101-RA ID=OSCA025101-RA|Name=OSCA025101-RA|organism=Ostrinia scapulalis|type=mRNA|length=219bp
ATGGCCGCTAGTTCAGCGTTATTTTTTTCATCATCATCATTTCAGCCATT
TTTGTGGAGCCACACTCTCCGAAGGGACCCCGATCGCATCCCTAAGCAGG
CTCTAGATTTGAACCCCCAAGGAAAACGCAAACGTGGTCGCCCCAAGCAA
ACTTGGCGGCGCGAGGCGAAGAAAATCGGCAAGACTTCGAGCGAGATCAA
ACGCGAAGCTCAATACTGA
back to top

spliced messenger RNA

>OSCA025101-RA ID=OSCA025101-RA|Name=OSCA025101-RA|organism=Ostrinia scapulalis|type=mRNA|length=219bp|location=Sequence derived from alignment at newscf_19912:2941..3159- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
ATGGCCGCTAGTTCAGCGTTATTTTTTTCATCATCATCATTTCAGCCATT
TTTGTGGAGCCACACTCTCCGAAGGGACCCCGATCGCATCCCTAAGCAGG
CTCTAGATTTGAACCCCCAAGGAAAACGCAAACGTGGTCGCCCCAAGCAA
ACTTGGCGGCGCGAGGCGAAGAAAATCGGCAAGACTTCGAGCGAGATCAA
ACGCGAAGCTCAATACTGA
back to top

protein sequence of OSCA025101-RA

>OSCA025101-PA ID=OSCA025101-PA|Name=OSCA025101-RA|organism=Ostrinia scapulalis|type=polypeptide|length=72bp
MAASSALFFSSSSFQPFLWSHTLRRDPDRIPKQALDLNPQGKRKRGRPKQ
TWRREAKKIGKTSSEIKREAQY
back to top

mRNA from alignment at newscf_19912:2941..3159-

Legend: CDSpolypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA025101-RA ID=OSCA025101-RA|Name=OSCA025101-RA|organism=Ostrinia scapulalis|type=mRNA|length=219bp|location=Sequence derived from alignment at newscf_19912:2941..3159- (Ostrinia scapulalis)
ATGGCCGCTAGTTCAGCGTTATTTTTTTCATCATCATCATTTCAGCCATT TTTGTGGAGCCACACTCTCCGAAGGGACCCCGATCGCATCCCTAAGCAGG CTCTAGATTTGAACCCCCAAGGAAAACGCAAACGTGGTCGCCCCAAGCAA ACTTGGCGGCGCGAGGCGAAGAAAATCGGCAAGACTTCGAGCGAGATCAA ACGCGAAGCTCAATACTGA
back to top

Coding sequence (CDS) from alignment at newscf_19912:2941..3159-

>OSCA025101-RA ID=OSCA025101-RA|Name=OSCA025101-RA|organism=Ostrinia scapulalis|type=CDS|length=219bp|location=Sequence derived from alignment at newscf_19912:2941..3159- (Ostrinia scapulalis)
ATGGCCGCTAGTTCAGCGTTATTTTTTTCATCATCATCATTTCAGCCATT
TTTGTGGAGCCACACTCTCCGAAGGGACCCCGATCGCATCCCTAAGCAGG
CTCTAGATTTGAACCCCCAAGGAAAACGCAAACGTGGTCGCCCCAAGCAA
ACTTGGCGGCGCGAGGCGAAGAAAATCGGCAAGACTTCGAGCGAGATCAA
ACGCGAAGCTCAATACTGA
back to top
Synonyms
The feature 'OSCA025101-RA' has the following synonyms
Synonym
augustus-newscf_19912-processed-gene-0.2-mRNA-1