OSCA025176-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA025176-RA
Unique NameOSCA025176-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length231
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_1997contignewscf_1997:2..232 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.09
QI0|-1|0|1|-1|1|1|0|76
AED0.05
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025176OSCA025176Ostrinia scapulalisgenenewscf_1997 2..232 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025176-RAOSCA025176-PAOstrinia scapulalispolypeptidenewscf_1997 2..232 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025176-RA:exon:1080OSCA025176-RA:exon:1080Ostrinia scapulalisexonnewscf_1997 2..232 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025176-RA:cdsOSCA025176-RA:cdsOstrinia scapulalisCDSnewscf_1997 2..232 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA025176-RA ID=OSCA025176-RA|Name=OSCA025176-RA|organism=Ostrinia scapulalis|type=mRNA|length=231bp
CAAAACAAACTTTTGTCCACAGACCACTTCGAAACCTGCCCAGAAGTGAA
GTACGTCAAATGGGTGCAGGCTTTAACATCAGCTGAAGACAAGCAAGACA
CTCCAGTGACATCTTCAAGTGAGAATGATGACTCCAACGGTTCAGAAGCC
GAAGAGAGCGCTGATGATGATGATGATGATGATGATGTGGGAGTCGCTAA
GAACAGATTCATGGCGCTTTTGGACGAGTAA
back to top

spliced messenger RNA

>OSCA025176-RA ID=OSCA025176-RA|Name=OSCA025176-RA|organism=Ostrinia scapulalis|type=mRNA|length=231bp|location=Sequence derived from alignment at newscf_1997:2..232+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
CAAAACAAACTTTTGTCCACAGACCACTTCGAAACCTGCCCAGAAGTGAA
GTACGTCAAATGGGTGCAGGCTTTAACATCAGCTGAAGACAAGCAAGACA
CTCCAGTGACATCTTCAAGTGAGAATGATGACTCCAACGGTTCAGAAGCC
GAAGAGAGCGCTGATGATGATGATGATGATGATGATGTGGGAGTCGCTAA
GAACAGATTCATGGCGCTTTTGGACGAGTAA
back to top

protein sequence of OSCA025176-RA

>OSCA025176-PA ID=OSCA025176-PA|Name=OSCA025176-RA|organism=Ostrinia scapulalis|type=polypeptide|length=76bp
QNKLLSTDHFETCPEVKYVKWVQALTSAEDKQDTPVTSSSENDDSNGSEA
EESADDDDDDDDVGVAKNRFMALLDE
back to top

mRNA from alignment at newscf_1997:2..232+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA025176-RA ID=OSCA025176-RA|Name=OSCA025176-RA|organism=Ostrinia scapulalis|type=mRNA|length=231bp|location=Sequence derived from alignment at newscf_1997:2..232+ (Ostrinia scapulalis)
CAAAACAAACTTTTGTCCACAGACCACTTCGAAACCTGCCCAGAAGTGAA GTACGTCAAATGGGTGCAGGCTTTAACATCAGCTGAAGACAAGCAAGACA CTCCAGTGACATCTTCAAGTGAGAATGATGACTCCAACGGTTCAGAAGCC GAAGAGAGCGCTGATGATGATGATGATGATGATGATGTGGGAGTCGCTAA GAACAGATTCATGGCGCTTTTGGACGAGTAA
back to top

Coding sequence (CDS) from alignment at newscf_1997:2..232+

>OSCA025176-RA ID=OSCA025176-RA|Name=OSCA025176-RA|organism=Ostrinia scapulalis|type=CDS|length=231bp|location=Sequence derived from alignment at newscf_1997:2..232+ (Ostrinia scapulalis)
CAAAACAAACTTTTGTCCACAGACCACTTCGAAACCTGCCCAGAAGTGAA
GTACGTCAAATGGGTGCAGGCTTTAACATCAGCTGAAGACAAGCAAGACA
CTCCAGTGACATCTTCAAGTGAGAATGATGACTCCAACGGTTCAGAAGCC
GAAGAGAGCGCTGATGATGATGATGATGATGATGATGTGGGAGTCGCTAA
GAACAGATTCATGGCGCTTTTGGACGAGTAA
back to top
Synonyms
The feature 'OSCA025176-RA' has the following synonyms
Synonym
augustus-newscf_1997-processed-gene-0.0-mRNA-1