OSCA025375-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA025375-RA
Unique NameOSCA025375-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length165
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25816contignewscf_25816:145..309 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.20
QI0|-1|0|1|-1|1|1|0|54
AED0.15
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025375OSCA025375Ostrinia scapulalisgenenewscf_25816 145..309 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025375-RAOSCA025375-PAOstrinia scapulalispolypeptidenewscf_25816 145..309 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025375-RA:exon:2811OSCA025375-RA:exon:2811Ostrinia scapulalisexonnewscf_25816 145..309 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025375-RA:cdsOSCA025375-RA:cdsOstrinia scapulalisCDSnewscf_25816 145..309 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA025375-RA ID=OSCA025375-RA|Name=OSCA025375-RA|organism=Ostrinia scapulalis|type=mRNA|length=165bp
CCAAATGACGTCCTCTGCTGGACAAAGGCCTCTCCCAAGGATTTCCACGA
CGACCGGTCCTGCGCCGCCCGCATCCAGGCACCTCCCGCGACCTTCATCA
GATCGTCGGTCCACCTAGTGTGGAGCCTGCCCACACTACGTGTTCCCGTC
CGTGGTCGCCACTAG
back to top

spliced messenger RNA

>OSCA025375-RA ID=OSCA025375-RA|Name=OSCA025375-RA|organism=Ostrinia scapulalis|type=mRNA|length=165bp|location=Sequence derived from alignment at newscf_25816:145..309+ (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
CCAAATGACGTCCTCTGCTGGACAAAGGCCTCTCCCAAGGATTTCCACGA
CGACCGGTCCTGCGCCGCCCGCATCCAGGCACCTCCCGCGACCTTCATCA
GATCGTCGGTCCACCTAGTGTGGAGCCTGCCCACACTACGTGTTCCCGTC
CGTGGTCGCCACTAG
back to top

protein sequence of OSCA025375-RA

>OSCA025375-PA ID=OSCA025375-PA|Name=OSCA025375-RA|organism=Ostrinia scapulalis|type=polypeptide|length=54bp
PNDVLCWTKASPKDFHDDRSCAARIQAPPATFIRSSVHLVWSLPTLRVPV
RGRH
back to top

mRNA from alignment at newscf_25816:145..309+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA025375-RA ID=OSCA025375-RA|Name=OSCA025375-RA|organism=Ostrinia scapulalis|type=mRNA|length=165bp|location=Sequence derived from alignment at newscf_25816:145..309+ (Ostrinia scapulalis)
CCAAATGACGTCCTCTGCTGGACAAAGGCCTCTCCCAAGGATTTCCACGA CGACCGGTCCTGCGCCGCCCGCATCCAGGCACCTCCCGCGACCTTCATCA GATCGTCGGTCCACCTAGTGTGGAGCCTGCCCACACTACGTGTTCCCGTC CGTGGTCGCCACTAG
back to top

Coding sequence (CDS) from alignment at newscf_25816:145..309+

>OSCA025375-RA ID=OSCA025375-RA|Name=OSCA025375-RA|organism=Ostrinia scapulalis|type=CDS|length=165bp|location=Sequence derived from alignment at newscf_25816:145..309+ (Ostrinia scapulalis)
CCAAATGACGTCCTCTGCTGGACAAAGGCCTCTCCCAAGGATTTCCACGA
CGACCGGTCCTGCGCCGCCCGCATCCAGGCACCTCCCGCGACCTTCATCA
GATCGTCGGTCCACCTAGTGTGGAGCCTGCCCACACTACGTGTTCCCGTC
CGTGGTCGCCACTAG
back to top
Synonyms
The feature 'OSCA025375-RA' has the following synonyms
Synonym
augustus-newscf_25816-processed-gene-0.0-mRNA-1