OSCA025968-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA025968-RA
Unique NameOSCA025968-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length174
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_46155contignewscf_46155:786..959 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.02
QI0|-1|0|1|-1|0|1|0|58
AED0.02
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA025968OSCA025968Ostrinia scapulalisgenenewscf_46155 786..959 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025968-RAOSCA025968-PAOstrinia scapulalispolypeptidenewscf_46155 786..959 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025968-RA:cdsOSCA025968-RA:cdsOstrinia scapulalisCDSnewscf_46155 786..959 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA025968-RA:exon:3407OSCA025968-RA:exon:3407Ostrinia scapulalisexonnewscf_46155 786..959 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA025968-RA ID=OSCA025968-RA|Name=OSCA025968-RA|organism=Ostrinia scapulalis|type=mRNA|length=174bp
GCAATTGCCGCCCTAAAACGTAAGAAGCGCTACGAAAAGCAGCTCACCCA
GATCGATGGCACTCTCACACAGATAGAAGCACAGAGGGAGGCCCTGGAGG
GAGCCACCACTAACGCACAGGTCCTCAACACGATGAAGGACGCTGCTAAT
GCAATGAAACTCGCTCACAAGGAC
back to top

spliced messenger RNA

>OSCA025968-RA ID=OSCA025968-RA|Name=OSCA025968-RA|organism=Ostrinia scapulalis|type=mRNA|length=174bp|location=Sequence derived from alignment at newscf_46155:786..959- (Ostrinia scapulalis)|Notes=Excludes all bases but those of type(s): exon.  
GCAATTGCCGCCCTAAAACGTAAGAAGCGCTACGAAAAGCAGCTCACCCA
GATCGATGGCACTCTCACACAGATAGAAGCACAGAGGGAGGCCCTGGAGG
GAGCCACCACTAACGCACAGGTCCTCAACACGATGAAGGACGCTGCTAAT
GCAATGAAACTCGCTCACAAGGAC
back to top

protein sequence of OSCA025968-RA

>OSCA025968-PA ID=OSCA025968-PA|Name=OSCA025968-RA|organism=Ostrinia scapulalis|type=polypeptide|length=58bp
AIAALKRKKRYEKQLTQIDGTLTQIEAQREALEGATTNAQVLNTMKDAAN
AMKLAHKD
back to top

mRNA from alignment at newscf_46155:786..959-

Legend: CDSpolypeptideexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA025968-RA ID=OSCA025968-RA|Name=OSCA025968-RA|organism=Ostrinia scapulalis|type=mRNA|length=174bp|location=Sequence derived from alignment at newscf_46155:786..959- (Ostrinia scapulalis)
GCAATTGCCGCCCTAAAACGTAAGAAGCGCTACGAAAAGCAGCTCACCCA GATCGATGGCACTCTCACACAGATAGAAGCACAGAGGGAGGCCCTGGAGG GAGCCACCACTAACGCACAGGTCCTCAACACGATGAAGGACGCTGCTAAT GCAATGAAACTCGCTCACAAGGAC
back to top

Coding sequence (CDS) from alignment at newscf_46155:786..959-

>OSCA025968-RA ID=OSCA025968-RA|Name=OSCA025968-RA|organism=Ostrinia scapulalis|type=CDS|length=174bp|location=Sequence derived from alignment at newscf_46155:786..959- (Ostrinia scapulalis)
GCAATTGCCGCCCTAAAACGTAAGAAGCGCTACGAAAAGCAGCTCACCCA
GATCGATGGCACTCTCACACAGATAGAAGCACAGAGGGAGGCCCTGGAGG
GAGCCACCACTAACGCACAGGTCCTCAACACGATGAAGGACGCTGCTAAT
GCAATGAAACTCGCTCACAAGGAC
back to top
Synonyms
The feature 'OSCA025968-RA' has the following synonyms
Synonym
augustus-newscf_46155-processed-gene-0.0-mRNA-1