HiSeq10018_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10018
Unique NameHiSeq10018_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length54
Homology
BLAST of HiSeq10018 vs. genbank:protein
Match: gi|913305939|ref|XP_013183376.1| (PREDICTED: probable Ras GTPase-activating protein isoform X3 [Amyelois transitella] >gi|913305941|ref|XP_013183378.1| PREDICTED: probable Ras GTPase-activating protein isoform X3 [Amyelois transitella])

HSP 1 Score: 108.227 bits (269), Expect = 3.630e-26
Identity = 50/54 (92.59%), Postives = 52/54 (96.30%), Query Frame = 0
Query:    1 MWKALVHRKRKYSEVIPCDRESYAALAAMQGGSAATLPPSLDALRAYTSYEKAC 54
            MWKA++HRKRKYSEV  CDRESYAALAAMQGGSAATLPPSLDALRAYTSYEKAC
Sbjct:   13 MWKAIIHRKRKYSEVSSCDRESYAALAAMQGGSAATLPPSLDALRAYTSYEKAC 66          
BLAST of HiSeq10018 vs. genbank:protein
Match: gi|1073528295|gb|JAT81259.1| (hypothetical protein g.6548, partial [Pectinophora gossypiella] >gi|1073545067|gb|JAT89645.1| hypothetical protein g.6550, partial [Pectinophora gossypiella])

HSP 1 Score: 98.9821 bits (245), Expect = 8.136e-24
Identity = 45/54 (83.33%), Postives = 51/54 (94.44%), Query Frame = 0
Query:    1 MWKALVHRKRKYSEVIPCDRESYAALAAMQGGSAATLPPSLDALRAYTSYEKAC 54
            MWKA++HR+RKYSE + CDRESYAALAAM GG++ATLPPSLDALRAYTSYEKAC
Sbjct:   12 MWKAIIHRRRKYSEDLECDRESYAALAAMAGGNSATLPPSLDALRAYTSYEKAC 65          
BLAST of HiSeq10018 vs. genbank:protein
Match: gi|910327238|ref|XP_013166791.1| (PREDICTED: probable Ras GTPase-activating protein isoform X6 [Papilio xuthus] >gi|910327240|ref|XP_013166792.1| PREDICTED: probable Ras GTPase-activating protein isoform X6 [Papilio xuthus])

HSP 1 Score: 100.138 bits (248), Expect = 2.629e-23
Identity = 45/55 (81.82%), Postives = 54/55 (98.18%), Query Frame = 0
Query:    1 MWKALVHRKRKYSEVIPCDRES-YAALAAMQGGSAATLPPSLDALRAYTSYEKAC 54
            MWKA+++RKRKYS+V+PCD+ES YAALAAMQGG+++TLPPSLDALRAYTSYEKAC
Sbjct:   13 MWKAIINRKRKYSDVLPCDQESSYAALAAMQGGNSSTLPPSLDALRAYTSYEKAC 67          
BLAST of HiSeq10018 vs. genbank:protein
Match: gi|768413718|ref|XP_011568990.1| (PREDICTED: probable Ras GTPase-activating protein isoform X2 [Plutella xylostella] >gi|768413720|ref|XP_011568991.1| PREDICTED: probable Ras GTPase-activating protein isoform X2 [Plutella xylostella])

HSP 1 Score: 98.2117 bits (243), Expect = 1.260e-22
Identity = 48/55 (87.27%), Postives = 50/55 (90.91%), Query Frame = 0
Query:    1 MWKALVHRKRKYSE-VIPCDRESYAALAAMQGGSAATLPPSLDALRAYTSYEKAC 54
            MWKALVHRKRKYSE  +  DRESYAALAAMQGG+AATLPPSLDA RAYTSYEKAC
Sbjct:   13 MWKALVHRKRKYSENQVAFDRESYAALAAMQGGNAATLPPSLDAFRAYTSYEKAC 67          
BLAST of HiSeq10018 vs. genbank:protein
Match: gi|914558763|gb|KOB66793.1| (Pho91p [Operophtera brumata])

HSP 1 Score: 82.0333 bits (201), Expect = 3.484e-19
Identity = 40/46 (86.96%), Postives = 44/46 (95.65%), Query Frame = 0
Query:    1 MWKALVHRKRKYSEVIPCDRESYAALAAMQGGSAATLPPSLDALRA 46
            MWK+L++RKRKYSE  PCDRESYAALAAMQGG+AATLPPSLDALRA
Sbjct:   13 MWKSLMNRKRKYSEQ-PCDRESYAALAAMQGGNAATLPPSLDALRA 57          
BLAST of HiSeq10018 vs. genbank:protein
Match: gi|930665560|gb|KPJ06688.1| (hypothetical protein RR48_11735 [Papilio machaon])

HSP 1 Score: 81.6481 bits (200), Expect = 4.231e-19
Identity = 37/50 (74.00%), Postives = 47/50 (94.00%), Query Frame = 0
Query:    1 MWKALVHRKRKYSEVIPCDRE-SYAALAAMQGGSAATLPPSLDALRAYTS 49
            MWKA+++RKRKYS+V+PCD+E SYAALAAMQGG+++TLPPSLDALRA  +
Sbjct:    1 MWKAIINRKRKYSDVLPCDQESSYAALAAMQGGNSSTLPPSLDALRASNN 50          
The following BLAST results are available for this feature:
BLAST of HiSeq10018 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 6
Match NameE-valueIdentityDescription
gi|913305939|ref|XP_013183376.1|3.630e-2692.59PREDICTED: probable Ras GTPase-activating protein ... [more]
gi|1073528295|gb|JAT81259.1|8.136e-2483.33hypothetical protein g.6548, partial [Pectinophora... [more]
gi|910327238|ref|XP_013166791.1|2.629e-2381.82PREDICTED: probable Ras GTPase-activating protein ... [more]
gi|768413718|ref|XP_011568990.1|1.260e-2287.27PREDICTED: probable Ras GTPase-activating protein ... [more]
gi|914558763|gb|KOB66793.1|3.484e-1986.96Pho91p [Operophtera brumata][more]
gi|930665560|gb|KPJ06688.1|4.231e-1974.00hypothetical protein RR48_11735 [Papilio machaon][more]
back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10018HiSeq10018Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10018_p ID=HiSeq10018_p|Name=HiSeq10018|organism=Ostrinia scapulalis|type=polypeptide|length=54bp
MWKALVHRKRKYSEVIPCDRESYAALAAMQGGSAATLPPSLDALRAYTSY
EKAC
back to top