HiSeq10063_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10063
Unique NameHiSeq10063_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length179
Homology
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|917955284|ref|NP_001299777.1| (gamma-glutamylcyclotransferase-like [Papilio xuthus] >gi|389611811|dbj|BAM19471.1| similar to CG32196 [Papilio xuthus] >gi|930652665|gb|KPI95004.1| Gamma-glutamylcyclotransferase [Papilio xuthus])

HSP 1 Score: 257.299 bits (656), Expect = 4.037e-85
Identity = 118/177 (66.67%), Postives = 146/177 (82.49%), Query Frame = 0
Query:    1 MSVSLKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNGNEASPKMIEKL 177
            M   +++TFLYFAYGSNLLKKRI INNPSA F+GIG+LD+H LDFIKYS++WRG+SATIVP +  HVWGAVW++   D+ +LD QEGV+TNWYFPKTV ++T  G  L+CRTYQQT+NP P  + +E+P +RRPS TYL CILTGA EC LP +YI+ L+KIPHNG +ASPK+IEKL
Sbjct:    1 MVTPVRDTFLYFAYGSNLLKKRIHINNPSAIFLGIGRLDDHQLDFIKYSDHWRGASATIVPTKSHHVWGAVWRVHNKDLQSLDWQEGVETNWYFPKTVKVVTPDGADLECRTYQQTINPPPRAEGEEIPHDRRPSITYLNCILTGAIECNLPKEYIEILKKIPHNGQQASPKLIEKL 177          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|512922278|ref|XP_004930081.1| (PREDICTED: gamma-glutamylcyclotransferase-like [Bombyx mori])

HSP 1 Score: 256.914 bits (655), Expect = 8.250e-85
Identity = 117/177 (66.10%), Postives = 144/177 (81.36%), Query Frame = 0
Query:    1 MSVSLKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNGNEASPKMIEKL 177
            M   +K+TFLYFAYGSNL KKRIRINNP+A F+G+G+LDNH LDFIKYSE+WRG+SATI+P E  HVWGA+W+L   D+P+LD QEGVDTNWYF K+V+++T  G ++QCRTYQQT+NP   K  +ELP ERRP  TYL+CI+ GA EC+LP  YI+ L+KIPHNG  AS KM+EKL
Sbjct:    9 MMDPIKDTFLYFAYGSNLFKKRIRINNPTAEFLGVGRLDNHQLDFIKYSEHWRGASATIMPTEHAHVWGAIWRLHDQDLPSLDRQEGVDTNWYFAKSVNVMTSDGVSVQCRTYQQTINPPLRKNGEELPLERRPCITYLDCIIKGAVECELPEYYIEELKKIPHNGQIASAKMLEKL 185          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|943970627|ref|XP_014366975.1| (PREDICTED: gamma-glutamylcyclotransferase-like [Papilio machaon] >gi|930667590|gb|KPJ08673.1| Gamma-glutamylcyclotransferase [Papilio machaon])

HSP 1 Score: 256.529 bits (654), Expect = 8.786e-85
Identity = 117/177 (66.10%), Postives = 145/177 (81.92%), Query Frame = 0
Query:    1 MSVSLKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNGNEASPKMIEKL 177
            M   +++TFLYFAYGSNLLKKRI INNPSA F+GIG+LD+H LDFIKYS++WRG+SATIVP +  HVWGA+W+L   D+ +LD QEGV+TNWYFPK V ++T  G  L+CRTYQQT+NP P  + +E+P +RRPS TYL CILTGA EC+LP +YI+ L+KIPHNG  ASPK+IEKL
Sbjct:    1 MVTPVRDTFLYFAYGSNLLKKRIHINNPSAIFLGIGRLDDHQLDFIKYSDHWRGASATIVPTKSHHVWGAIWRLHNKDLKSLDWQEGVETNWYFPKIVKVVTPDGVDLECRTYQQTINPPPRAEGEEIPHDRRPSITYLNCILTGAVECKLPKEYIEKLKKIPHNGQHASPKLIEKL 177          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|909559711|ref|XP_013134919.1| (PREDICTED: gamma-glutamylcyclotransferase-like [Papilio polytes])

HSP 1 Score: 256.144 bits (653), Expect = 1.421e-84
Identity = 118/177 (66.67%), Postives = 145/177 (81.92%), Query Frame = 0
Query:    1 MSVSLKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNGNEASPKMIEKL 177
            M   +++TFLYFAYGSNLLKKRI INNPSA F+GIG+LD+H LDFIKYS++WRGSSATIVP++  HVWGAVW++   D+ +LD QEGV+TNWYFPK V ++T  G  L+CRTYQQT+NP P  + +E+P +RRPS TYL CILTGA EC LP +YI+ L+KIPHNG  ASPK+IEKL
Sbjct:    1 MVTPVRDTFLYFAYGSNLLKKRIHINNPSAIFLGIGRLDDHQLDFIKYSDHWRGSSATIVPIKNHHVWGAVWRVHNKDLKSLDWQEGVETNWYFPKIVKVVTPDGTDLECRTYQQTINPPPRAEGEEIPLDRRPSITYLNCILTGAIECNLPKEYIEKLKKIPHNGQHASPKLIEKL 177          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|357630701|gb|EHJ78649.1| (gamma-glutamyl cyclotransferase-like venom protein isoform 1 [Danaus plexippus])

HSP 1 Score: 251.906 bits (642), Expect = 3.565e-83
Identity = 119/171 (69.59%), Postives = 142/171 (83.04%), Query Frame = 0
Query:    7 ETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNGNEASPKMIEKL 177
            +TFLYFAYGSNLLKKRI INNP+A FIGIGKL+   LDFIKYS+NWRGSSATI+P++  ++WGAVW+L   DM +LD QEGV++NWYFPK+VDI+T  GE L+CRTYQQT+NP P    +ELP ERRPSSTY++CI+ GA EC LP DYI  L+KIPHNG +AS KMIEKL
Sbjct:    4 DTFLYFAYGSNLLKKRIHINNPTAVFIGIGKLN---LDFIKYSDNWRGSSATIIPIQNHYIWGAVWRLHNNDMKSLDRQEGVESNWYFPKSVDIVTPEGEKLKCRTYQQTINPPPRAPGEELPIERRPSSTYMDCIIKGAIECNLPEDYIMKLKKIPHNGQKASQKMIEKL 171          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|913331117|ref|XP_013197115.1| (PREDICTED: gamma-glutamylcyclotransferase-like [Amyelois transitella] >gi|913331119|ref|XP_013197116.1| PREDICTED: gamma-glutamylcyclotransferase-like [Amyelois transitella])

HSP 1 Score: 248.825 bits (634), Expect = 6.888e-82
Identity = 116/178 (65.17%), Postives = 143/178 (80.34%), Query Frame = 0
Query:    1 MSVSLKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNGNEASPKMIEKLK 178
            M  ++K+TFLYFAYGSNL  KRI INNPSA FIG+GKL+++ LDFIKYS+NWRGSSATIVPVEG  VWGA+W+++ I MPALD QEGV+TNWYFPKTV I T  G+ ++CRTYQQT+NP P +   ++P +RRPS TY+ECIL GA EC LP +YI+ L +IPHNG EA P M + L+
Sbjct:    1 MISNIKDTFLYFAYGSNLFNKRIHINNPSAVFIGVGKLEDYQLDFIKYSDNWRGSSATIVPVEGSQVWGAIWRVENIHMPALDRQEGVETNWYFPKTVTIFTEDGKKVECRTYQQTINPPPRRDDQDIPIDRRPSMTYMECILKGAKECGLPKEYIKKLERIPHNGQEA-PNMKKLLE 177          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|1073536677|gb|JAT85450.1| (hypothetical protein g.4150 [Pectinophora gossypiella])

HSP 1 Score: 245.743 bits (626), Expect = 1.481e-80
Identity = 112/175 (64.00%), Postives = 143/175 (81.71%), Query Frame = 0
Query:    5 LKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDE-LPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNGNEASPKMIEKLK 178
            L++TFLYFAYGSNLLKKRI INNPSA F+G GKL+NH LDFI+Y++NW G SATIVP EG HVWGAVW+++  DMPALD QEGV++NWYFPK V+I+   G  ++CRTYQQ+ NP P + + E +P+ER+PS TY+E I+ GA EC +P  YI+ L+KIPHNG EASP+M++KL+
Sbjct:    4 LQDTFLYFAYGSNLLKKRIHINNPSAEFLGTGKLENHQLDFIRYTDNWGGCSATIVPTEGAHVWGAVWRVNNKDMPALDKQEGVESNWYFPKIVEIVLPEGTIVECRTYQQSNNP-PVRGVGEDIPDERKPSKTYMEVIIHGAMECDIPEYYIEKLKKIPHNGKEASPEMLDKLR 177          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|768412088|ref|XP_011567259.1| (PREDICTED: gamma-glutamylcyclotransferase-like [Plutella xylostella])

HSP 1 Score: 209.534 bits (532), Expect = 4.648e-66
Identity = 104/165 (63.03%), Postives = 121/165 (73.33%), Query Frame = 0
Query:    9 FLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEG------CH-VWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNG 166
            FLYFAYGSNLLKKRI INNPSA FIGIG+LD++ ++FIKY   W+G SATIVP +       C  VWG VW L   DMPALD QEGV TNWYFPKTV I T  G+ L+CRTYQQ+VNP        +P +RRPS TYL+CI+ GA EC+LP +YIQ L+ IPHNG
Sbjct:    9 FLYFAYGSNLLKKRIHINNPSAEFIGIGRLDHYQVNFIKYGPRWKGCSATIVPTDNRCLCKTCKCVWGTVWMLHNNDMPALDEQEGVSTNWYFPKTVKIETEEGKILECRTYQQSVNPPATCDHTSIPPDRRPSETYLKCIVLGAIECKLPKEYIQLLKLIPHNG 173          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|1059384495|ref|XP_017787052.1| (PREDICTED: gamma-glutamylcyclotransferase-like isoform X1 [Nicrophorus vespilloides])

HSP 1 Score: 196.823 bits (499), Expect = 2.858e-61
Identity = 88/162 (54.32%), Postives = 114/162 (70.37%), Query Frame = 0
Query:    5 LKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNG 166
            + +TFLYFAYGSNLL +RI+INNPSA    IGKL  + LDF  YS  W+G+SATIVP    HVWGA+W++D+ ++P LD QEGVD N YFP  V+++   GE++QCR YQQT++P     I +LP ER+PS  YL+ I  G  E +LP DY++ L  IP NG
Sbjct:    1 MSKTFLYFAYGSNLLAQRIKINNPSAERYAIGKLQGYRLDFATYSSRWKGASATIVPQSDAHVWGAIWEIDMKNLPDLDRQEGVDRNIYFPLEVNVVNPEGESIQCRVYQQTISPSFIHNIKDLPSERKPSPIYLKTIQLGGVESKLPEDYVKFLNTIPDNG 162          
BLAST of HiSeq10063 vs. genbank:protein
Match: gi|1000746159|ref|XP_015595842.1| (PREDICTED: gamma-glutamylcyclotransferase-like [Cephus cinctus] >gi|1000746161|ref|XP_015595843.1| PREDICTED: gamma-glutamylcyclotransferase-like [Cephus cinctus])

HSP 1 Score: 191.815 bits (486), Expect = 2.473e-59
Identity = 93/162 (57.41%), Postives = 113/162 (69.75%), Query Frame = 0
Query:    5 LKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSENWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDIITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQLPNDYIQNLRKIPHNG 166
            +  +FLYFAYGSNLL KRIRINNP+A    IG+L N  LDFI +S+ W G++ATIVP E  HVWG +W++D  +M  LD QEGV    YFP TVD+ T +G +LQCR YQQ  NP      + LPEERRPS  YL  IL+GA E  LP++YIQ L+ IPHNG
Sbjct:    1 MANSFLYFAYGSNLLTKRIRINNPTAIKKDIGRLKNFRLDFITFSKRWHGAAATIVPTENSHVWGVIWEIDNSNMSDLDEQEGVADKIYFPMTVDVETPNGTSLQCRVYQQCKNPEENVTTELLPEERRPSPLYLNTILSGARENGLPHEYIQFLQSIPHNG 162          
The following BLAST results are available for this feature:
BLAST of HiSeq10063 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|917955284|ref|NP_001299777.1|4.037e-8566.67gamma-glutamylcyclotransferase-like [Papilio xuthu... [more]
gi|512922278|ref|XP_004930081.1|8.250e-8566.10PREDICTED: gamma-glutamylcyclotransferase-like [Bo... [more]
gi|943970627|ref|XP_014366975.1|8.786e-8566.10PREDICTED: gamma-glutamylcyclotransferase-like [Pa... [more]
gi|909559711|ref|XP_013134919.1|1.421e-8466.67PREDICTED: gamma-glutamylcyclotransferase-like [Pa... [more]
gi|357630701|gb|EHJ78649.1|3.565e-8369.59gamma-glutamyl cyclotransferase-like venom protein... [more]
gi|913331117|ref|XP_013197115.1|6.888e-8265.17PREDICTED: gamma-glutamylcyclotransferase-like [Am... [more]
gi|1073536677|gb|JAT85450.1|1.481e-8064.00hypothetical protein g.4150 [Pectinophora gossypie... [more]
gi|768412088|ref|XP_011567259.1|4.648e-6663.03PREDICTED: gamma-glutamylcyclotransferase-like [Pl... [more]
gi|1059384495|ref|XP_017787052.1|2.858e-6154.32PREDICTED: gamma-glutamylcyclotransferase-like iso... [more]
gi|1000746159|ref|XP_015595842.1|2.473e-5957.41PREDICTED: gamma-glutamylcyclotransferase-like [Ce... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006750 glutathione biosynthetic process
molecular_function GO:0003839 gamma-glutamylcyclotransferase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013024Butirosin biosynthesis, BtrG-likeGENE3D3.10.490.10coord: 6..174
e-value: 2.1E-46
score: 157.1
IPR013024Butirosin biosynthesis, BtrG-likeSUPERFAMILY110857Gamma-glutamyl cyclotransferase-likecoord: 8..124
NoneNo IPR availablePFAMPF13772AIG2_2coord: 66..159
e-value: 1.1E-22
score: 79.7
IPR017939Gamma-glutamylcyclotransferasePANTHERPTHR12935UNCHARACTERIZEDcoord: 7..177

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10063HiSeq10063Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10063_p ID=HiSeq10063_p|Name=HiSeq10063|organism=Ostrinia scapulalis|type=polypeptide|length=179bp
MSVSLKETFLYFAYGSNLLKKRIRINNPSAHFIGIGKLDNHHLDFIKYSE
NWRGSSATIVPVEGCHVWGAVWQLDIIDMPALDIQEGVDTNWYFPKTVDI
ITLHGETLQCRTYQQTVNPVPCKKIDELPEERRPSSTYLECILTGATECQ
LPNDYIQNLRKIPHNGNEASPKMIEKLKN
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006750glutathione biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0003839gamma-glutamylcyclotransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR017939G-Glutamylcylcotransferase
IPR013024Butirosin_synth_BtrG-like