HiSeq10087_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10087
Unique NameHiSeq10087_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length158
Homology
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914573912|gb|KOB76330.1| (putative tick transposon [Operophtera brumata])

HSP 1 Score: 121.324 bits (303), Expect = 6.653e-31
Identity = 69/158 (43.67%), Postives = 99/158 (62.66%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQL--EFSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F  A +DSS SDHKQIY+E+ K +    ++ QY + DY+ L+  + +     E + Y+ LE +I + I  SK  KTKI NLP+ DWINKEIID IN+RN LW ++K ++ N   + ++   RNKV + I   K  +Y N+F     +PKK+W+LINTL
Sbjct:   72 FKFALLDSSSSDHKQIYLELSKYRSQTKQRIQYEAVDYENLHKGINDATYTNEENKYDYLENFINTHITDSKIYKTKIMNLPRDDWINKEIIDMINRRNLLWQQIKADKRNEALKNKFIVERNKVGKRISADKSKYYYNEFMKCSNSPKKMWNLINTL 229          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914572445|gb|KOB75310.1| (putative tick transposon [Operophtera brumata])

HSP 1 Score: 122.094 bits (305), Expect = 7.578e-31
Identity = 64/157 (40.76%), Postives = 102/157 (64.97%), Query Frame = 0
Query:    4 LATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQLE---FSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            +A ++SSLSDHKQIY+E+ + +P + KK  Y + +Y KLY  +++E       + Y  LE+ +  SI+K K +KTK++N PK DWINK++I +IN RN LW++LK+   + + R ++   RN  R+ ++ TK  +Y N F+  + NP  +W LIN+L
Sbjct:    1 MAIIESSLSDHKQIYLEVNRIQPERPKKLHYEAVNYIKLYETIRQEMTSANLMNEYKRLEDLLQKSISKDKVMKTKLQNAPKADWINKDMIKSINIRNILWHKLKQNPKDEENRNKFIQQRNFTRRYMQTTKNQYYHNAFQKCERNPLNMWQLINSL 157          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914565328|gb|KOB70396.1| (putative tick transposon [Operophtera brumata])

HSP 1 Score: 120.939 bits (302), Expect = 1.284e-30
Identity = 74/158 (46.84%), Postives = 101/158 (63.92%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQL--EFSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F LA +++ +SDHKQIY E+KK K   LKK  Y + +Y KLY  ++E ++  E   Y+ LEE +L  I KSK  KTK+ N P++DWINK I+D IN RN LW   KR  ++  K+E Y   RN+V + I+ TK  +YL  F+G K  P K+W+LIN L
Sbjct:   62 FHLAIIETPMSDHKQIYFEVKKCKVTSLKKNSYEAINYDKLYKTVEESEINNEEHLYHLLEERLLLCIKKSKTTKTKLLNPPRQDWINKTILDEINIRNVLWAGHKRNPEDEIKKEIYIKKRNEVSEHIQNTKSKYYLKAFDGCKKKPAKMWNLINNL 219          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914574778|gb|KOB77018.1| (putative tick transposon, partial [Operophtera brumata])

HSP 1 Score: 124.405 bits (311), Expect = 1.747e-30
Identity = 65/159 (40.88%), Postives = 103/159 (64.78%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQLE---FSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F +A ++SSLSDHKQIY+E+ + +P + KK  Y + +Y KLY  +++E       + Y  LE+ +  SI+K K +KTK++N PK DWINK++I +IN RN LW++LK+   + + R ++   RN  R+ ++ TK  +Y N F+  + NP  +W LIN+L
Sbjct:  173 FHMAIIESSLSDHKQIYLEVNRIQPERPKKLHYEAVNYIKLYETIRQEMTSANLMNEYKRLEDLLQKSISKDKVMKTKLQNAPKADWINKDMIKSINIRNILWHKLKQNPKDEENRNKFIQQRNFTRRYMQTTKNQYYHNAFQKCERNPLNMWQLINSL 331          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914566242|gb|KOB70976.1| (putative tick transposon [Operophtera brumata])

HSP 1 Score: 121.324 bits (303), Expect = 2.871e-30
Identity = 69/158 (43.67%), Postives = 99/158 (62.66%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQL--EFSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F  A +DSS SDHKQIY+E+ K +    ++ QY + DY+ L+  + +     E + Y+ LE +I + I  SK  KTKI NLP+ DWINKEIID IN+RN LW ++K ++ N   + ++   RNKV + I   K  +Y N+F     +PKK+W+LINTL
Sbjct:  132 FKFALLDSSSSDHKQIYLELSKYRSQTKQRIQYEAVDYENLHKGINDATYTNEENKYDYLENFINTHITDSKIYKTKIMNLPRDDWINKEIIDMINRRNLLWQQIKADKRNEALKNKFIVERNKVGKRISADKSKYYYNEFMKCSNSPKKMWNLINTL 289          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914558727|gb|KOB66776.1| (putative tick transposon [Operophtera brumata])

HSP 1 Score: 124.79 bits (312), Expect = 3.067e-30
Identity = 65/159 (40.88%), Postives = 103/159 (64.78%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQLE---FSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F +A ++SSLSDHKQIY+E+ + +P + KK  Y + +Y KLY  +++E       + Y  LE+ +  SI+K K +KTK++N PK DWINK++I +IN RN LW++LK+   + + R ++   RN  R+ ++ TK  +Y N F+  + NP  +W LIN+L
Sbjct:  466 FHMAIIESSLSDHKQIYLEVNRIQPERPKKLHYEAVNYIKLYETIRQEMTSANLMNEYKRLEDLLQKSISKDKVMKTKLQNAPKADWINKDMIKSINIRNILWHKLKQNPKDEENRNKFIQQRNFTRRYMQTTKNQYYHNAFQKCERNPLNMWQLINSL 624          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|913304460|ref|XP_013201177.1| (PREDICTED: uncharacterized protein LOC106143594 [Amyelois transitella])

HSP 1 Score: 120.553 bits (301), Expect = 1.709e-29
Identity = 67/157 (42.68%), Postives = 100/157 (63.69%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQLEFS-NYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F L+ ++S+L+DH QIY+EI K  P + K  +Y + DYKKLY  M     +   +Y +LE+ I+  +  SK  KTKI+N P+KDWI+KEIIDAIN RN++  E K   +++  ++ +   RN V+ +I++ KE +Y   FE     PK++W LINTL
Sbjct:   97 FSLSIIESALTDHNQIYLEIGKLAPERSKPIRYTALDYKKLYESMSALVHDGDEDYCNLEKDIIDKVENSKIEKTKIQNPPQKDWIHKEIIDAINTRNQICLETKINPNDVDLKKTFTEQRNIVQTMIERHKENYYHKLFEDTHNQPKRMWELINTL 253          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914572126|gb|KOB75078.1| (putative tick transposon [Operophtera brumata])

HSP 1 Score: 120.939 bits (302), Expect = 4.681e-29
Identity = 70/158 (44.30%), Postives = 99/158 (62.66%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQL--EFSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F  A +DSS SDHKQIY+E+ K +    ++ QY + DY+ L+  + +     E + Y+ LE +I + I  SK  KTKI NLPK DWINKEIID IN+RN LW ++K ++ N   + ++   RNKV + I   K  +Y N+F     +PKK+W+LINTL
Sbjct:  235 FKFALLDSSSSDHKQIYLELSKYRSQTKQRIQYEAVDYENLHKGINDATYTNEENKYDYLENFINTHITDSKIYKTKIINLPKDDWINKEIIDMINRRNLLWQQIKADKRNEALKNKFIVERNKVGKRISADKSKYYYNEFMKCSNSPKKMWNLINTL 392          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914572125|gb|KOB75077.1| (putative tick transposon, partial [Operophtera brumata])

HSP 1 Score: 120.939 bits (302), Expect = 9.215e-29
Identity = 69/158 (43.67%), Postives = 99/158 (62.66%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQL--EFSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F  A +DSS SDHKQIY+E+ K +    ++ QY + DY+ L+  + +     E + Y+ LE +I + I  SK  KTKI NLP+ DWINKEIID IN+RN LW ++K ++ N   + ++   RNKV + I   K  +Y N+F     +PKK+W+LINTL
Sbjct:  220 FKFALLDSSSSDHKQIYLELSKYRSQTKQRIQYEAVDYENLHKGINDATYTNEENKYDYLENFINTHITDSKIYKTKIMNLPRDDWINKEIIDMINRRNLLWQQIKADKRNEALKNKFIVERNKVGKRISADKSKYYYNEFMKCSNSPKKMWNLINTL 377          
BLAST of HiSeq10087 vs. genbank:protein
Match: gi|914575837|gb|KOB77810.1| (putative tick transposon [Operophtera brumata])

HSP 1 Score: 117.857 bits (294), Expect = 9.291e-28
Identity = 67/158 (42.41%), Postives = 102/158 (64.56%), Query Frame = 0
Query:    2 FXLATVDSSLSDHKQIYVEIKKTKP-PKLKKTQYNSTDYKKLYNYMQEEQLE-FSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKLWNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKLWSLINTL 157
            F +A ++SSLSDHKQIYVE+KK KP PK++ T+Y + DY KL+   +E++++  +++  LE  I   +  SK IK KI N P+KDWINK+I+  INQRN +W E K+  ++     E+   R++  ++I+ TK  +Y  +F      PK +W+LIN L
Sbjct:  455 FHMAIINSSLSDHKQIYVELKKFKPIPKIQ-TKYEAIDYTKLHATAKEDKIDDLNDFTLLENKIKEYMQDSKTIKMKILNKPQKDWINKDILTGINQRNYIWTEHKKNPEDESLETEFKTKRDRTAKLIRDTKNSYYYKEFTKCINKPKHMWNLINKL 611          
The following BLAST results are available for this feature:
BLAST of HiSeq10087 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914573912|gb|KOB76330.1|6.653e-3143.67putative tick transposon [Operophtera brumata][more]
gi|914572445|gb|KOB75310.1|7.578e-3140.76putative tick transposon [Operophtera brumata][more]
gi|914565328|gb|KOB70396.1|1.284e-3046.84putative tick transposon [Operophtera brumata][more]
gi|914574778|gb|KOB77018.1|1.747e-3040.88putative tick transposon, partial [Operophtera bru... [more]
gi|914566242|gb|KOB70976.1|2.871e-3043.67putative tick transposon [Operophtera brumata][more]
gi|914558727|gb|KOB66776.1|3.067e-3040.88putative tick transposon [Operophtera brumata][more]
gi|913304460|ref|XP_013201177.1|1.709e-2942.68PREDICTED: uncharacterized protein LOC106143594 [A... [more]
gi|914572126|gb|KOB75078.1|4.681e-2944.30putative tick transposon [Operophtera brumata][more]
gi|914572125|gb|KOB75077.1|9.215e-2943.67putative tick transposon, partial [Operophtera bru... [more]
gi|914575837|gb|KOB77810.1|9.291e-2842.41putative tick transposon [Operophtera brumata][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0009987 cellular process
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10087HiSeq10087Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10087_p ID=HiSeq10087_p|Name=HiSeq10087|organism=Ostrinia scapulalis|type=polypeptide|length=158bp
MFXLATVDSSLSDHKQIYVEIKKTKPPKLKKTQYNSTDYKKLYNYMQEEQ
LEFSNYNDLEEYILSSINKSKEIKTKIENLPKKDWINKEIIDAINQRNKL
WNELKREQDNLQKREEYYNLRNKVRQIIKKTKEIFYLNKFEGLKGNPKKL
WSLINTLX
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0009987cellular process