HiSeq10117_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10117
Unique NameHiSeq10117_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length125
Homology
BLAST of HiSeq10117 vs. genbank:protein
Match: gi|1061795352|dbj|BAV56820.1| (chemosensory protein 16 [Ostrinia furnacalis])

HSP 1 Score: 257.684 bits (657), Expect = 5.602e-87
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
Query:    1 MSHRKVLVLSHLMVFLCVQCFAKLHNYDNFDMETLLLNTTRSRALFECVRDETKCANKEDKEMKDDIFEMVTTSCANCTAKEKQKFGDAMKALHRSMGESQIITMFINKMTNMFQGGLSDTEKTT 125
            MSHRKVLVLSHLMVFLCVQCFAKLHNYDNFDMETLLLNTTRSRALFECVRDETKCANKEDKEMKDDIFEMVTTSCANCTAKEKQKFGDAMKALHRSMGESQIITMFINKMTNMFQGGLSDTEKTT
Sbjct:    1 MSHRKVLVLSHLMVFLCVQCFAKLHNYDNFDMETLLLNTTRSRALFECVRDETKCANKEDKEMKDDIFEMVTTSCANCTAKEKQKFGDAMKALHRSMGESQIITMFINKMTNMFQGGLSDTEKTT 125          
BLAST of HiSeq10117 vs. genbank:protein
Match: gi|723592617|gb|AIX97838.1| (chemosensory protein [Cnaphalocrocis medinalis])

HSP 1 Score: 94.7449 bits (234), Expect = 8.355e-23
Identity = 49/104 (47.12%), Postives = 72/104 (69.23%), Query Frame = 0
Query:   19 QCFAKLHNYDNFDMETLLLNTTRSRALFECVRDETKCANKEDKEMKDDIFEMVTTSCANCTAKEKQKFGDAMKALHRSMGESQIITMFINKMTNMFQGGLSDTE 122
            QC+AKLHNY+NFD+E+ L N  +++A   CV D++KC ++ D EMK+DI EM+ TSCA CT KEK+K+ + +  L +S+G+ Q  T   N+  N+F  G +D E
Sbjct:   13 QCYAKLHNYENFDLESFLSNEAKAKAFLGCVSDDSKCGSQGDLEMKNDIVEMMMTSCAGCTEKEKEKYKEGLAVLQKSVGDPQ--TAMFNQFANLFLWG-TDPE 113          
BLAST of HiSeq10117 vs. genbank:protein
Match: gi|768442830|ref|XP_011563202.1| (PREDICTED: uncharacterized protein LOC105393165 [Plutella xylostella])

HSP 1 Score: 67.0106 bits (162), Expect = 3.566e-12
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 0
Query:   12 LMVFLCVQCFAKLHNYDNFDMETLLLNTTRSRALFECVRDETKCANKEDKEMKDDIFEMVTTSCANCTAKEKQKFGDAMKAL 93
            L++   V C  K HNYD FD+   L N  ++++   C ++E  C  + DKE + DI EMV TSCA C  KEK+ +  A + +
Sbjct:    8 LVIVAYVSC--KYHNYDTFDLAAYLANPEKTKSFVACFKNEKDCKTQYDKEFRLDIKEMVATSCAACNQKEKENYQKAYQTI 87          
The following BLAST results are available for this feature:
BLAST of HiSeq10117 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 3
Match NameE-valueIdentityDescription
gi|1061795352|dbj|BAV56820.1|5.602e-87100.00chemosensory protein 16 [Ostrinia furnacalis][more]
gi|723592617|gb|AIX97838.1|8.355e-2347.12chemosensory protein [Cnaphalocrocis medinalis][more]
gi|768442830|ref|XP_011563202.1|3.566e-1239.02PREDICTED: uncharacterized protein LOC105393165 [P... [more]
back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005055Insect odorant-binding protein A10/Ejaculatory bulb-specific protein 3PFAMPF03392OS-Dcoord: 26..97
e-value: 6.3E-13
score: 48.4
IPR005055Insect odorant-binding protein A10/Ejaculatory bulb-specific protein 3GENE3D1.10.2080.10coord: 26..96
e-value: 2.4E-13
score: 49.5
IPR005055Insect odorant-binding protein A10/Ejaculatory bulb-specific protein 3SUPERFAMILY100910Chemosensory protein Csp2coord: 26..97
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 18..22
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 6..17
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 23..125
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..5
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..22
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..22
score: 0.653
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..24
score: 0.459
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.721

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10117HiSeq10117Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10117_p ID=HiSeq10117_p|Name=HiSeq10117|organism=Ostrinia scapulalis|type=polypeptide|length=125bp
MSHRKVLVLSHLMVFLCVQCFAKLHNYDNFDMETLLLNTTRSRALFECVR
DETKCANKEDKEMKDDIFEMVTTSCANCTAKEKQKFGDAMKALHRSMGES
QIITMFINKMTNMFQGGLSDTEKTT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR005055OS_D_A10/PebIII