HiSeq10147_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10147
Unique NameHiSeq10147_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length181
Homology
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|913326860|ref|XP_013194861.1| (PREDICTED: caltractin-like [Amyelois transitella])

HSP 1 Score: 306.605 bits (784), Expect = 1.331e-104
Identity = 149/181 (82.32%), Postives = 163/181 (90.06%), Query Frame = 0
Query:    1 MNPAEDLAEREADAEVEPEEKEKTICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVTP 181
            MNP E L E + D E+  EEKEKT+CARL+LTLEQENDLREAFN LD+ GEGKIKA DFRV IKALGYEPTKEELQ M+  VDKGDTGKLSFENF+TAIMRKIMS D+DGDIMKSFRLFD+DDSGLISFENVK+VT+ILGTYLTDEEIEEMIDDADKD+DGFI+V EFMRMIKN V+IVTP
Sbjct:    1 MNPDESLGEVDQDTEIPAEEKEKTVCARLILTLEQENDLREAFNSLDHLGEGKIKAADFRVVIKALGYEPTKEELQHMINAVDKGDTGKLSFENFQTAIMRKIMSLDTDGDIMKSFRLFDMDDSGLISFENVKKVTEILGTYLTDEEIEEMIDDADKDFDGFINVQEFMRMIKNSVHIVTP 181          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|357623692|gb|EHJ74742.1| (putative centrin [Danaus plexippus])

HSP 1 Score: 273.478 bits (698), Expect = 1.704e-91
Identity = 131/169 (77.51%), Postives = 151/169 (89.35%), Query Frame = 0
Query:   13 DAEVEPEEKEKTICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVTP 181
            D E+E E+ EKT+CARL+   EQ++DL++AF+LLDY GEGKI+AEDFRVAIKALGYEPTKEELQ+M+ GVDKG TGKLSFENFETAIMRK+MS DSDGDIMKSFRLFD++D+G IS ENVK VT ILGTYLTDEEI+EM+DDAD DYDG+IS  EFM+MIKN VNIVTP
Sbjct:   13 DIELEEEKPEKTVCARLIFDNEQKSDLQQAFDLLDYNGEGKIRAEDFRVAIKALGYEPTKEELQKMISGVDKGQTGKLSFENFETAIMRKVMSLDSDGDIMKSFRLFDMNDTGFISVENVKRVTDILGTYLTDEEIDEMVDDADTDYDGYISAQEFMKMIKNSVNIVTP 181          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|512907643|ref|XP_004926494.1| (PREDICTED: caltractin-like isoform X1 [Bombyx mori])

HSP 1 Score: 264.618 bits (675), Expect = 6.433e-88
Identity = 129/156 (82.69%), Postives = 142/156 (91.03%), Query Frame = 0
Query:   25 ICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVT 180
            + ARL+ + EQE DLREAFNLLDYTGEGKI+AEDFRVAIKALGYEPT EELQ M++ VDKGDTGKLSFENFETAIMRKIM+ DSDGDIMKSFRLFD DDSG I+FENVK+V+QILGTYLTDEEIEEMIDDADKD+DG ISV EFM+MIKN V+I T
Sbjct:   31 VHARLIFSKEQEQDLREAFNLLDYTGEGKIRAEDFRVAIKALGYEPTNEELQTMIRAVDKGDTGKLSFENFETAIMRKIMALDSDGDIMKSFRLFDDDDSGFINFENVKKVSQILGTYLTDEEIEEMIDDADKDFDGLISVEEFMKMIKNSVHIET 186          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|512907647|ref|XP_004926495.1| (PREDICTED: caltractin-like isoform X2 [Bombyx mori])

HSP 1 Score: 264.233 bits (674), Expect = 8.341e-88
Identity = 132/174 (75.86%), Postives = 148/174 (85.06%), Query Frame = 0
Query:    7 LAEREADAEVEPEEKEKTICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVT 180
            +A   ++ ++    K   I A+L LT  QE DLREAFNLLDYTGEGKI+AEDFRVAIKALGYEPT EELQ M++ VDKGDTGKLSFENFETAIMRKIM+ DSDGDIMKSFRLFD DDSG I+FENVK+V+QILGTYLTDEEIEEMIDDADKD+DG ISV EFM+MIKN V+I T
Sbjct:   10 IAYSNSEEDLNQSSKVNEIKAKLTLTNAQEQDLREAFNLLDYTGEGKIRAEDFRVAIKALGYEPTNEELQTMIRAVDKGDTGKLSFENFETAIMRKIMALDSDGDIMKSFRLFDDDDSGFINFENVKKVSQILGTYLTDEEIEEMIDDADKDFDGLISVEEFMKMIKNSVHIET 183          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|827547587|ref|XP_012546095.1| (PREDICTED: caltractin-like isoform X3 [Bombyx mori])

HSP 1 Score: 253.832 bits (647), Expect = 7.482e-84
Identity = 124/146 (84.93%), Postives = 135/146 (92.47%), Query Frame = 0
Query:   35 QENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVT 180
            +E DLREAFNLLDYTGEGKI+AEDFRVAIKALGYEPT EELQ M++ VDKGDTGKLSFENFETAIMRKIM+ DSDGDIMKSFRLFD DDSG I+FENVK+V+QILGTYLTDEEIEEMIDDADKD+DG ISV EFM+MIKN V+I T
Sbjct:   24 KEQDLREAFNLLDYTGEGKIRAEDFRVAIKALGYEPTNEELQTMIRAVDKGDTGKLSFENFETAIMRKIMALDSDGDIMKSFRLFDDDDSGFINFENVKKVSQILGTYLTDEEIEEMIDDADKDFDGLISVEEFMKMIKNSVHIET 169          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|943947099|ref|XP_014356685.1| (PREDICTED: caltractin-like [Papilio machaon] >gi|930676201|gb|KPJ16380.1| Centrin-2 [Papilio machaon])

HSP 1 Score: 251.521 bits (641), Expect = 8.224e-83
Identity = 125/161 (77.64%), Postives = 139/161 (86.34%), Query Frame = 0
Query:   21 KEKTICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVTP 181
            KEK++ ARL+ T +Q+ DLR+AFNLLD+TGEGKIKA+DFRVAIKALGYEPTKEELQ M+  VDK  TGKLSFENFETAIMRKIMS DSDGDIMKSFRLFD  D G ISFENVK V++ILG  LTDEEIEE++DDADKD+DGFISV EFMRMIK  V I TP
Sbjct:   20 KEKSVSARLIFTEQQKRDLRDAFNLLDHTGEGKIKADDFRVAIKALGYEPTKEELQHMINRVDKNQTGKLSFENFETAIMRKIMSLDSDGDIMKSFRLFDDGDCGFISFENVKRVSEILGFGLTDEEIEEIMDDADKDFDGFISVQEFMRMIKTSVRIETP 180          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|910341194|ref|XP_013174299.1| (PREDICTED: caltractin-like [Papilio xuthus])

HSP 1 Score: 251.136 bits (640), Expect = 1.168e-82
Identity = 125/161 (77.64%), Postives = 139/161 (86.34%), Query Frame = 0
Query:   21 KEKTICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVTP 181
            KEK++ ARL+ T +Q+ DLR+AFNLLD+TGEGKIKA+DFRVAIKALGYEPTKEELQ M+  VDK  TGKLSFENFETAIMRKIMS DSDGDIMKSFRLFD  D G ISFENVK V++ILG  LTDEEIEE++DDADKD+DGFISV EFMRMIK  V I TP
Sbjct:   20 KEKSVSARLIFTEQQKRDLRDAFNLLDHTGEGKIKADDFRVAIKALGYEPTKEELQHMINRVDKTQTGKLSFENFETAIMRKIMSLDSDGDIMKSFRLFDDGDCGFISFENVKRVSEILGFGLTDEEIEEIMDDADKDFDGFISVQEFMRMIKTSVRIETP 180          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|909566275|ref|XP_013138497.1| (PREDICTED: caltractin-like [Papilio polytes])

HSP 1 Score: 246.514 bits (628), Expect = 6.421e-81
Identity = 123/158 (77.85%), Postives = 137/158 (86.71%), Query Frame = 0
Query:   24 TICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVTP 181
            ++ ARL+ T +Q+ DLR+AFNLLD+TGEGKIKA+DFRVAIKALGYEPTKEELQ M+  VDK  TGKLSFENFETAIMRKIMS DSDGDIMKSFRLFD  DSG ISFENVK V++ILG  LTDEEIEE++DDADKD+DGFISV EFMRMIK  V I TP
Sbjct:   21 SVSARLIFTDQQKKDLRDAFNLLDHTGEGKIKADDFRVAIKALGYEPTKEELQLMINRVDKTQTGKLSFENFETAIMRKIMSLDSDGDIMKSFRLFDDGDSGFISFENVKRVSEILGFGLTDEEIEEIMDDADKDFDGFISVQEFMRMIKTSVRIETP 178          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|768427946|ref|XP_011555088.1| (PREDICTED: caltractin-like isoform X1 [Plutella xylostella])

HSP 1 Score: 244.588 bits (623), Expect = 1.535e-79
Identity = 129/174 (74.14%), Postives = 149/174 (85.63%), Query Frame = 0
Query:    8 AEREADAEVEPEEKEKTICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFISVSEFMRMIKNCVNIVTP 181
            AE   + ++EP+ +EKT+CARL LT EQ+NDL +AFN LDY GEGKIKAEDFRVAIKALGYEPT+EEL+ M+ GVDK  +GKLSFENFETAIMRKIMS DSDGDIMKSFRLFD DDSGLISFEN+K VT ILG  LTDEEIEEMI+DADKD++G++S  EFMR++K  V IVTP
Sbjct:   44 AEEALEEKIEPQNEEKTVCARLFLTEEQKNDLLQAFNYLDYNGEGKIKAEDFRVAIKALGYEPTEEELKNMINGVDKAGSGKLSFENFETAIMRKIMSLDSDGDIMKSFRLFDCDDSGLISFENLKRVTGILGISLTDEEIEEMIEDADKDFNGYVSAQEFMRILKYAVPIVTP 217          
BLAST of HiSeq10147 vs. genbank:protein
Match: gi|930656901|gb|KPI99223.1| (Centrin-1 [Papilio xuthus])

HSP 1 Score: 224.942 bits (572), Expect = 1.461e-72
Identity = 111/143 (77.62%), Postives = 126/143 (88.11%), Query Frame = 0
Query:   21 KEKTICARLVLTLEQENDLREAFNLLDYTGEGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIMRKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEEMIDDADKDYDGFI 163
            KEK++ ARL+ T +Q+ DLR+AFNLLD+TGEGKIKA+DFRVAIKALGYEPTKEELQ M+  VDK  TGKLSFENFETAIMRKIMS DSDGDIMKSFRLFD  D G ISFENVK V++ILG  LTDEEIEE++DDADKD+DGF+
Sbjct:   20 KEKSVSARLIFTEQQKRDLRDAFNLLDHTGEGKIKADDFRVAIKALGYEPTKEELQHMINRVDKTQTGKLSFENFETAIMRKIMSLDSDGDIMKSFRLFDDGDCGFISFENVKRVSEILGFGLTDEEIEEIMDDADKDFDGFV 162          
The following BLAST results are available for this feature:
BLAST of HiSeq10147 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913326860|ref|XP_013194861.1|1.331e-10482.32PREDICTED: caltractin-like [Amyelois transitella][more]
gi|357623692|gb|EHJ74742.1|1.704e-9177.51putative centrin [Danaus plexippus][more]
gi|512907643|ref|XP_004926494.1|6.433e-8882.69PREDICTED: caltractin-like isoform X1 [Bombyx mori... [more]
gi|512907647|ref|XP_004926495.1|8.341e-8875.86PREDICTED: caltractin-like isoform X2 [Bombyx mori... [more]
gi|827547587|ref|XP_012546095.1|7.482e-8484.93PREDICTED: caltractin-like isoform X3 [Bombyx mori... [more]
gi|943947099|ref|XP_014356685.1|8.224e-8377.64PREDICTED: caltractin-like [Papilio machaon] >gi|9... [more]
gi|910341194|ref|XP_013174299.1|1.168e-8277.64PREDICTED: caltractin-like [Papilio xuthus][more]
gi|909566275|ref|XP_013138497.1|6.421e-8177.85PREDICTED: caltractin-like [Papilio polytes][more]
gi|768427946|ref|XP_011555088.1|1.535e-7974.14PREDICTED: caltractin-like isoform X1 [Plutella xy... [more]
gi|930656901|gb|KPI99223.1|1.461e-7277.62Centrin-1 [Papilio xuthus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005815 microtubule organizing center
molecular_function GO:0005509 calcium ion binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054EFhcoord: 38..66
e-value: 0.12
score: 21.5
coord: 74..102
e-value: 12.0
score: 9.0
coord: 147..175
e-value: 2.7E-5
score: 33.6
coord: 111..139
e-value: 0.93
score: 18.0
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 34..69
score: 12.282
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 143..178
score: 13.565
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 70..105
score: 8.934
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 107..142
score: 11.835
IPR011992EF-hand domain pairPFAMPF13499EF-hand_7coord: 112..172
e-value: 1.2E-11
score: 44.4
coord: 39..99
e-value: 4.5E-9
score: 36.2
IPR011992EF-hand domain pairGENE3D1.10.238.10coord: 31..97
e-value: 2.7E-20
score: 71.8
IPR011992EF-hand domain pairGENE3D1.10.238.10coord: 98..174
e-value: 1.6E-19
score: 69.3
NoneNo IPR availablePANTHERPTHR23050CALCIUM BINDING PROTEINcoord: 31..173
NoneNo IPR availableSUPERFAMILY47473EF-handcoord: 31..174
IPR029527Centrin-1PANTHERPTHR23050:SF141CENTRIN-1coord: 31..173

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10147HiSeq10147Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10147_p ID=HiSeq10147_p|Name=HiSeq10147|organism=Ostrinia scapulalis|type=polypeptide|length=181bp
MNPAEDLAEREADAEVEPEEKEKTICARLVLTLEQENDLREAFNLLDYTG
EGKIKAEDFRVAIKALGYEPTKEELQQMVQGVDKGDTGKLSFENFETAIM
RKIMSQDSDGDIMKSFRLFDIDDSGLISFENVKEVTQILGTYLTDEEIEE
MIDDADKDYDGFISVSEFMRMIKNCVNIVTP
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005815microtubule organizing center
Vocabulary: Molecular Function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: INTERPRO
TermDefinition
IPR029527CETN1
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom