HiSeq10151_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10151
Unique NameHiSeq10151_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length84
Homology
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|512902192|ref|XP_004925315.1| (PREDICTED: coiled-coil domain-containing protein 103 [Bombyx mori])

HSP 1 Score: 133.65 bits (335), Expect = 2.873e-39
Identity = 61/84 (72.62%), Postives = 74/84 (88.10%), Query Frame = 0
Query:    1 MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQYAAKEKEDQE 84
            MNKPL+ +DIAAME+QLRNCV +DRK+WQ+NDVKCDAI+TAK+YEEFADRV+AAHLRPLEKSD+K K +R+WNQ A   K  +E
Sbjct:    1 MNKPLNQEDIAAMENQLRNCVEDDRKYWQVNDVKCDAIHTAKTYEEFADRVSAAHLRPLEKSDYKQKIRRTWNQCATNTKNVEE 84          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|914543125|gb|KOB56131.1| (Uncharacterized protein OBRU01_25847 [Operophtera brumata])

HSP 1 Score: 129.798 bits (325), Expect = 1.006e-37
Identity = 61/80 (76.25%), Postives = 69/80 (86.25%), Query Frame = 0
Query:    1 MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQYAAKEK 80
            M KPLS DD+ AMESQLR+ V EDRK+W++NDVKCDAIY+AKSYEEFADRVAAAHL PLEK DFKNK+   WNQ+A KEK
Sbjct:    1 MVKPLSQDDVRAMESQLRSSVEEDRKYWRVNDVKCDAIYSAKSYEEFADRVAAAHLTPLEKKDFKNKSSLGWNQFAKKEK 80          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|930658639|gb|KPJ00842.1| (Coiled-coil domain-containing protein 103 [Papilio xuthus])

HSP 1 Score: 129.413 bits (324), Expect = 2.023e-37
Identity = 62/85 (72.94%), Postives = 73/85 (85.88%), Query Frame = 0
Query:    1 MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQYAAKEK--EDQ 83
            M  PLSADD  AME QLR C+ EDR++ ++N+VKCDAI+TAK+YEEFADRVAAAHLRPLEK+D+KNK  RSWNQYAAK+K  EDQ
Sbjct:    1 MVTPLSADDFTAMEGQLRECLEEDRRYTRVNNVKCDAIHTAKTYEEFADRVAAAHLRPLEKNDYKNKLPRSWNQYAAKDKANEDQ 85          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|943973875|ref|XP_014368285.1| (PREDICTED: coiled-coil domain-containing protein 103 [Papilio machaon] >gi|930666556|gb|KPJ07670.1| Coiled-coil domain-containing protein 103 [Papilio machaon])

HSP 1 Score: 127.872 bits (320), Expect = 7.253e-37
Identity = 59/80 (73.75%), Postives = 69/80 (86.25%), Query Frame = 0
Query:    1 MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQYAAKEK 80
            M  PLSADD  AME QLR C+ EDR++ ++N+VKCDAI+TAK+YEEFADRVAAAHLRPLEK D+KNK  RSWNQYAAK+K
Sbjct:    1 MVTPLSADDFTAMEGQLRECLEEDRRYTRVNNVKCDAIHTAKTYEEFADRVAAAHLRPLEKDDYKNKFSRSWNQYAAKDK 80          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|913321015|ref|XP_013191650.1| (PREDICTED: coiled-coil domain-containing protein 103 [Amyelois transitella])

HSP 1 Score: 127.487 bits (319), Expect = 7.807e-37
Identity = 59/81 (72.84%), Postives = 72/81 (88.89%), Query Frame = 0
Query:    1 MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQYAAKEKE 81
            M+KPL  DDI+AME+QLR+ V +DR +W++NDVKCDAIYTAK+YEEFADRVAAAHLRPLEK+D+++K K  WNQYA KEKE
Sbjct:    1 MDKPLGLDDISAMENQLRSSVEQDRHYWRVNDVKCDAIYTAKTYEEFADRVAAAHLRPLEKADYRSK-KSGWNQYAVKEKE 80          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|357609142|gb|EHJ66318.1| (hypothetical protein KGM_02172 [Danaus plexippus])

HSP 1 Score: 123.635 bits (309), Expect = 2.733e-35
Identity = 58/81 (71.60%), Postives = 68/81 (83.95%), Query Frame = 0
Query:    1 MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQYAAKEKE 81
            MNKPLS DDI AMESQL+  + ED+ +W++NDVKCDAI+TAKSYEEFADRVAAAHLRPL+K D K K+  SWNQYA+K  E
Sbjct:    1 MNKPLSRDDIEAMESQLKQSLEEDKAYWRVNDVKCDAIHTAKSYEEFADRVAAAHLRPLDKEDMKKKSASSWNQYASKHDE 81          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|909555878|ref|XP_013149456.1| (PREDICTED: coiled-coil domain-containing protein 103 [Papilio polytes])

HSP 1 Score: 122.865 bits (307), Expect = 5.678e-35
Identity = 55/78 (70.51%), Postives = 66/78 (84.62%), Query Frame = 0
Query:    1 MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQYAAK 78
            M  PLSADD  AME QLR C+ EDR++ ++N+VKCDAI+TAK+YEEFADRVAAAHL+PLEK D+KNK  RSWNQYA +
Sbjct:    1 MVTPLSADDFTAMEGQLRECLEEDRRYLRVNNVKCDAIHTAKTYEEFADRVAAAHLQPLEKEDYKNKFPRSWNQYAGR 78          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|1059417597|ref|XP_017781628.1| (PREDICTED: coiled-coil domain-containing protein 103 [Nicrophorus vespilloides])

HSP 1 Score: 60.8474 bits (146), Expect = 1.965e-10
Identity = 29/67 (43.28%), Postives = 42/67 (62.69%), Query Frame = 0
Query:   13 MESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQYAAKE 79
            + ++L+  +A D+ +W  ND K  A  T+K Y EF D VAAAHL PLEK D   +AK +WN+   ++
Sbjct:   13 LYAELKGAIASDKLYWVRNDAKIRASTTSKDYNEFRDIVAAAHLNPLEKQDRIGEAKSNWNKTTTRD 79          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|1080064667|ref|XP_018574473.1| (PREDICTED: coiled-coil domain-containing protein 103 [Anoplophora glabripennis])

HSP 1 Score: 60.077 bits (144), Expect = 3.245e-10
Identity = 27/62 (43.55%), Postives = 42/62 (67.74%), Query Frame = 0
Query:   13 MESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSWNQ 74
            M  +L++ + +++ +W  ND K  A+ T++SY+EF D VAAAHL+PL K D   K + SWN+
Sbjct:   13 MYKELQSSINKEKLYWIRNDAKLRAVVTSQSYDEFRDIVAAAHLKPLSKKDITEKRQMSWNK 74          
BLAST of HiSeq10151 vs. genbank:protein
Match: gi|642930431|ref|XP_008196398.1| (PREDICTED: coiled-coil domain-containing protein 103 [Tribolium castaneum] >gi|1008446930|ref|XP_015837622.1| PREDICTED: coiled-coil domain-containing protein 103 [Tribolium castaneum] >gi|1004398159|gb|EFA05848.2| hypothetical protein TcasGA2_TC008639 [Tribolium castaneum])

HSP 1 Score: 56.225 bits (134), Expect = 9.488e-9
Identity = 27/57 (47.37%), Postives = 41/57 (71.93%), Query Frame = 0
Query:   16 QLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADRVAAAHLRPLEKSDFKNKAKRSW 72
            +L++ + ED+ +W  ND K  A+ ++KSY+EF D VAAAHL+P+ K D K + +RSW
Sbjct:   14 ELKSAIDEDKMYWLKNDAKLRAVNSSKSYDEFRDIVAAAHLQPVTKKD-KERNQRSW 69          
The following BLAST results are available for this feature:
BLAST of HiSeq10151 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 10
Match NameE-valueIdentityDescription
gi|512902192|ref|XP_004925315.1|2.873e-3972.62PREDICTED: coiled-coil domain-containing protein 1... [more]
gi|914543125|gb|KOB56131.1|1.006e-3776.25Uncharacterized protein OBRU01_25847 [Operophtera ... [more]
gi|930658639|gb|KPJ00842.1|2.023e-3772.94Coiled-coil domain-containing protein 103 [Papilio... [more]
gi|943973875|ref|XP_014368285.1|7.253e-3773.75PREDICTED: coiled-coil domain-containing protein 1... [more]
gi|913321015|ref|XP_013191650.1|7.807e-3772.84PREDICTED: coiled-coil domain-containing protein 1... [more]
gi|357609142|gb|EHJ66318.1|2.733e-3571.60hypothetical protein KGM_02172 [Danaus plexippus][more]
gi|909555878|ref|XP_013149456.1|5.678e-3570.51PREDICTED: coiled-coil domain-containing protein 1... [more]
gi|1059417597|ref|XP_017781628.1|1.965e-1043.28PREDICTED: coiled-coil domain-containing protein 1... [more]
gi|1080064667|ref|XP_018574473.1|3.245e-1043.55PREDICTED: coiled-coil domain-containing protein 1... [more]
gi|642930431|ref|XP_008196398.1|9.488e-947.37PREDICTED: coiled-coil domain-containing protein 1... [more]
back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10151HiSeq10151Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10151_p ID=HiSeq10151_p|Name=HiSeq10151|organism=Ostrinia scapulalis|type=polypeptide|length=84bp
MNKPLSADDIAAMESQLRNCVAEDRKHWQINDVKCDAIYTAKSYEEFADR
VAAAHLRPLEKSDFKNKAKRSWNQYAAKEKEDQE
back to top