HiSeq12058_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12058
Unique NameHiSeq12058_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length204
Homology
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|268306366|gb|ACY95304.1| (ribosomal protein L13A [Manduca sexta])

HSP 1 Score: 401.749 bits (1031), Expect = 1.868e-141
Identity = 195/203 (96.06%), Postives = 200/203 (98.52%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQ+NISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGK ALRRLRAYDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYR+VVRKLEDKRK+KAVKRVAYERKLKKITKDAGEKV KA APFT+VIQSYGY
Sbjct:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKSALRRLRAYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYREVVRKLEDKRKVKAVKRVAYERKLKKITKDAGEKVVKATAPFTSVIQSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|913335319|ref|XP_013199417.1| (PREDICTED: 60S ribosomal protein L13a [Amyelois transitella])

HSP 1 Score: 399.823 bits (1026), Expect = 1.129e-140
Identity = 195/203 (96.06%), Postives = 199/203 (98.03%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRK KAV +VAYERKLKKITKDAGEKV KA APF+AVI+SYGY
Sbjct:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKAVHKVAYERKLKKITKDAGEKVAKATAPFSAVIKSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|31340317|sp|Q8MUR4.1|RL13A_CHOPR (RecName: Full=60S ribosomal protein L13a >gi|21435720|gb|AAM53949.1|AF514334_1 ribosomal protein L13A [Choristoneura parallela])

HSP 1 Score: 399.053 bits (1024), Expect = 1.830e-140
Identity = 194/203 (95.57%), Postives = 199/203 (98.03%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLR+YDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYR+VVRKLEDKRK KAV +VAYERKLKKITKDAG KV+KA APFTAVIQSYGY
Sbjct:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRSYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYREVVRKLEDKRKFKAVHKVAYERKLKKITKDAGAKVSKATAPFTAVIQSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|914098250|ref|NP_001298635.1| (60S ribosomal protein L13a [Papilio polytes] >gi|389610885|dbj|BAM19053.1| ribosomal protein L13A [Papilio polytes])

HSP 1 Score: 395.201 bits (1014), Expect = 7.464e-139
Identity = 189/203 (93.10%), Postives = 199/203 (98.03%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAI+IDGRGHLLGRL+AVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRK KAV +VA+ER+LK+ITK+AGEKV KA APFT++IQSYGY
Sbjct:    1 MTGFSNKAIIIDGRGHLLGRLSAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKAVHKVAFERRLKRITKEAGEKVAKATAPFTSIIQSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|914615801|ref|NP_001299163.1| (60S ribosomal protein L13a [Papilio xuthus] >gi|389608161|dbj|BAM17692.1| ribosomal protein L13A [Papilio xuthus] >gi|930654690|gb|KPI97023.1| 60S ribosomal protein L13a [Papilio xuthus])

HSP 1 Score: 394.815 bits (1013), Expect = 9.295e-139
Identity = 188/203 (92.61%), Postives = 199/203 (98.03%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAI+IDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKR+ KA+ +VA+ER+LK+ITK+AGEKV KA APFT++IQSYGY
Sbjct:    1 MTGFSNKAIIIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRRFKAIHKVAFERRLKRITKEAGEKVAKATAPFTSIIQSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|342356425|gb|AEL28871.1| (ribosomal protein L13A [Heliconius melpomene cythera])

HSP 1 Score: 394.045 bits (1011), Expect = 2.116e-138
Identity = 189/203 (93.10%), Postives = 197/203 (97.04%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSK+LWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRK K + +V+YE+KLKKITK+AGEKV KA APF AV+QSYGY
Sbjct:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKVLWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKTIHKVSYEKKLKKITKEAGEKVAKATAPFNAVMQSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|310769831|gb|ADP21473.1| (ribosomal protein L13A [Antheraea yamamai])

HSP 1 Score: 393.275 bits (1009), Expect = 3.870e-138
Identity = 186/203 (91.63%), Postives = 199/203 (98.03%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGN+VVVVRCEQ+NISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGK ALRRLR+YDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYR+VVRKLEDKRK+KAV++++YERKLKKITK+AGEKV KA APFT ++QSYGY
Sbjct:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNRVVVVRCEQINISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKSALRRLRSYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYREVVRKLEDKRKVKAVRQISYERKLKKITKEAGEKVAKATAPFTTIVQSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|357602430|gb|EHJ63396.1| (60S ribosomal protein L13a [Danaus plexippus])

HSP 1 Score: 392.889 bits (1008), Expect = 5.261e-138
Identity = 188/203 (92.61%), Postives = 196/203 (96.55%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSK+LWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYD+RRRVVVPAALRVFCL+PGRKYCHVGRLSHEVGWKYRDVVRKLEDKRK K + +VAYE KLKKITK+AGEKV K  APFTA++QSYGY
Sbjct:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKVLWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRVVVPAALRVFCLRPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKTIHKVAYENKLKKITKEAGEKVAKTTAPFTAIMQSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|315115437|gb|ADT80691.1| (ribosomal protein L13A [Euphydryas aurinia])

HSP 1 Score: 392.504 bits (1007), Expect = 8.071e-138
Identity = 188/203 (92.61%), Postives = 196/203 (96.55%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKV+VVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRK K + +VAYE+KL+KITK+AGEKV K  APF AV+QSYGY
Sbjct:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVIVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKFKTIHKVAYEKKLQKITKEAGEKVAKVTAPFNAVMQSYGY 203          
BLAST of HiSeq12058 vs. genbank:protein
Match: gi|31340318|sp|Q962U0.1|RL13A_SPOFR (RecName: Full=60S ribosomal protein L13a >gi|15213762|gb|AAK92156.1|AF400184_1 ribosomal protein L13A [Spodoptera frugiperda] >gi|288226777|gb|ADC44873.1| 60S ribosomal protein L13a [Spodoptera littoralis])

HSP 1 Score: 392.119 bits (1006), Expect = 9.941e-138
Identity = 188/203 (92.61%), Postives = 198/203 (97.54%), Query Frame = 0
Query:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDALRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQSYGY 203
            MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQ+NISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGK ALRRLRAYDGCPPPYD+RRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLE+KRK+K+VK +AYE+KLK+ITK++GEKV K  APFTAVIQSYGY
Sbjct:    1 MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKSALRRLRAYDGCPPPYDNRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWKYRDVVRKLENKRKVKSVKLMAYEKKLKRITKESGEKVAKTTAPFTAVIQSYGY 203          
The following BLAST results are available for this feature:
BLAST of HiSeq12058 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|268306366|gb|ACY95304.1|1.868e-14196.06ribosomal protein L13A [Manduca sexta][more]
gi|913335319|ref|XP_013199417.1|1.129e-14096.06PREDICTED: 60S ribosomal protein L13a [Amyelois tr... [more]
gi|31340317|sp|Q8MUR4.1|RL13A_CHOPR1.830e-14095.57RecName: Full=60S ribosomal protein L13a >gi|21435... [more]
gi|914098250|ref|NP_001298635.1|7.464e-13993.1060S ribosomal protein L13a [Papilio polytes] >gi|3... [more]
gi|914615801|ref|NP_001299163.1|9.295e-13992.6160S ribosomal protein L13a [Papilio xuthus] >gi|38... [more]
gi|342356425|gb|AEL28871.1|2.116e-13893.10ribosomal protein L13A [Heliconius melpomene cythe... [more]
gi|310769831|gb|ADP21473.1|3.870e-13891.63ribosomal protein L13A [Antheraea yamamai][more]
gi|357602430|gb|EHJ63396.1|5.261e-13892.6160S ribosomal protein L13a [Danaus plexippus][more]
gi|315115437|gb|ADT80691.1|8.071e-13892.61ribosomal protein L13A [Euphydryas aurinia][more]
gi|31340318|sp|Q962U0.1|RL13A_SPOFR9.941e-13892.61RecName: Full=60S ribosomal protein L13a >gi|15213... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006412 translation
cellular_component GO:0015934 large ribosomal subunit
cellular_component GO:0005840 ribosome
molecular_function GO:0003735 structural constituent of ribosome
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023564Ribosomal protein L13 domainGENE3D3.90.1180.10coord: 9..151
e-value: 2.2E-57
score: 192.5
IPR023564Ribosomal protein L13 domainSUPERFAMILY52161Ribosomal protein L13coord: 9..151
IPR005822Ribosomal protein L13PFAMPF00572Ribosomal_L13coord: 9..122
e-value: 2.1E-25
score: 89.1
IPR005822Ribosomal protein L13PANTHERPTHR11545RIBOSOMAL PROTEIN L13coord: 1..203
IPR005822Ribosomal protein L13HAMAPMF_01366Ribosomal_L13coord: 8..144
score: 19.321
IPR005755Ribosomal protein L13, eukaryotic/archaealTIGRFAMTIGR01077TIGR01077coord: 9..151
e-value: 1.4E-56
score: 188.7
IPR005755Ribosomal protein L13, eukaryotic/archaealPANTHERPTHR11545:SF360S RIBOSOMAL PROTEIN L13Acoord: 1..203
IPR023563Ribosomal protein L13, conserved sitePROSITEPS00783RIBOSOMAL_L13coord: 86..109

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12058HiSeq12058Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12058_p ID=HiSeq12058_p|Name=HiSeq12058|organism=Ostrinia scapulalis|type=polypeptide|length=204bp
MTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQLNISGNFF
RNKLKFMSFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKDA
LRRLRAYDGCPPPYDSRRRVVVPAALRVFCLKPGRKYCHVGRLSHEVGWK
YRDVVRKLEDKRKIKAVKRVAYERKLKKITKDAGEKVTKAVAPFTAVIQS
YGYN
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0015934large ribosomal subunit
GO:0005840ribosome
Vocabulary: Molecular Function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: Biological Process
TermDefinition
GO:0006412translation
Vocabulary: INTERPRO
TermDefinition
IPR023563Ribosomal_L13_CS
IPR005755Ribosomal_L13_euk/arc
IPR005822Ribosomal_L13
IPR023564Ribosomal_L13_dom