HiSeq12059_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12059
Unique NameHiSeq12059_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length173
Homology
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|768435024|ref|XP_011558937.1| (PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Plutella xylostella])

HSP 1 Score: 252.677 bits (644), Expect = 1.634e-83
Identity = 122/171 (71.35%), Postives = 139/171 (81.29%), Query Frame = 0
Query:    1 MASKIRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVK 171
            M SKI +SEVN +DGEQFEWMFGNV+ELCTDA+AQV K +PF DV +LC  F  YLD LS + KVV+L LHPDLAGRL++ G LTKES  EQ SAGL DLT EQR TI+  NE+YK KFGFPFIICARENKVQSII GL  RY+++R+QEI T INEVKKICKLRI DIV+
Sbjct:    1 MNSKIDISEVNTIDGEQFEWMFGNVIELCTDASAQVYKDKPFNDVEDLCDKFHSYLDGLSEKGKVVVLNLHPDLAGRLSSAGHLTKESAGEQLSAGLLDLTTEQRDTIHYHNEKYKIKFGFPFIICARENKVQSIIEGLLKRYHNTRQQEIDTAINEVKKICKLRILDIVQ 171          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|913310072|ref|XP_013185654.1| (PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Amyelois transitella])

HSP 1 Score: 247.669 bits (631), Expect = 1.449e-81
Identity = 120/167 (71.86%), Postives = 139/167 (83.23%), Query Frame = 0
Query:    7 VSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVKDD 173
            +SEVN LDGEQFE +FGNV+ELCTDAA Q QK++PF+DV  LC+AF  YLDNL+  EK+VIL+LHPDLAGR+AAQGELT+ES  EQRSAGL DL+ EQ  TIN  N  Y+ KFGFPFIICARENKVQSII GLQ RY +++EQEI  GI EVKKIC+LRI DIVK+D
Sbjct:    6 ISEVNALDGEQFEAIFGNVIELCTDAAVQAQKEKPFKDVKGLCEAFVRYLDNLTEPEKLVILQLHPDLAGRMAAQGELTRESNDEQRSAGLLDLSNEQMETINIRNYSYREKFGFPFIICARENKVQSIIEGLQRRYTNTKEQEICIGIEEVKKICRLRILDIVKND 172          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|943944422|ref|XP_014355562.1| (PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Papilio machaon] >gi|930677065|gb|KPJ17200.1| 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [Papilio machaon])

HSP 1 Score: 236.884 bits (603), Expect = 2.857e-77
Identity = 111/170 (65.29%), Postives = 140/170 (82.35%), Query Frame = 0
Query:    3 SKIRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVKD 172
            + + +SEVN LD  QFE +FGNV+E C  A   ++K RPF++V ELC AF++YLD+++ EEK+ +LK HPDLAGRLA QGELT ES +EQRSAGLNDLTEEQ+  +++ N+RYKSKFGFPFIICARENK+QSI+SGLQ RYN++  QE+ TGINEVKKICKLRI +IV +
Sbjct:    2 TSLTISEVNSLDDNQFETVFGNVIEHCKSAPVMIKKLRPFKNVNELCDAFQKYLDDINEEEKLAVLKSHPDLAGRLAQQGELTPESTEEQRSAGLNDLTEEQKRIMDDRNKRYKSKFGFPFIICARENKLQSILSGLQHRYNNNYNQEVETGINEVKKICKLRILNIVTE 171          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|910343384|ref|XP_013175457.1| (PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Papilio xuthus])

HSP 1 Score: 234.572 bits (597), Expect = 2.052e-76
Identity = 110/168 (65.48%), Postives = 140/168 (83.33%), Query Frame = 0
Query:    3 SKIRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIV 170
            + + +SEVN LD  QFE +FGNV+E C  A   ++K RPF++V ELC AF++YLD+++ EEK+ +LK HPDLAGRLA QG+LT ESK+EQRSAGLNDLTEEQ+  +++ N+RYK KFGFPFIICARENKVQSI+ GLQ+RYN++ +QE+ TGINEVKKICKLRI +IV
Sbjct:    2 TTLTISEVNLLDDNQFETVFGNVIEHCKSAPVMIKKLRPFKNVNELCDAFQKYLDDINKEEKLAVLKSHPDLAGRLAQQGDLTPESKEEQRSAGLNDLTEEQKQIMDDRNKRYKLKFGFPFIICARENKVQSILYGLQNRYNNNYDQEVVTGINEVKKICKLRILNIV 169          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|909559568|ref|XP_013134844.1| (PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Papilio polytes])

HSP 1 Score: 231.876 bits (590), Expect = 3.356e-75
Identity = 108/171 (63.16%), Postives = 141/171 (82.46%), Query Frame = 0
Query:    3 SKIRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVKDD 173
            + + +SEVN L+  QFE +FGNV+E C  A   ++K RPF++V ELC AF++YLD+++ EEK+ +LK HPDLAGRLA QGELT ES +EQRSAGLNDLT+EQ+  +++ N RYKSKFGFPFIICARENKVQSI+ GL++RYN++ +QE+ TGINEVKKICKLRI +IV ++
Sbjct:    2 TSLTISEVNSLNENQFETVFGNVIEHCKGAPVMIKKLRPFKNVNELCDAFQKYLDDINEEEKLAVLKSHPDLAGRLAQQGELTPESTEEQRSAGLNDLTQEQKRIMDDRNTRYKSKFGFPFIICARENKVQSILDGLKNRYNNNYDQEVQTGINEVKKICKLRILNIVTNE 172          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|357603793|gb|EHJ63921.1| (hypothetical protein KGM_05096 [Danaus plexippus])

HSP 1 Score: 215.698 bits (548), Expect = 9.288e-69
Identity = 109/177 (61.58%), Postives = 130/177 (73.45%), Query Frame = 0
Query:   17 QFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEE--------------------KVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVKDD 173
            +F+ +FGNV+ELC  AA  V+  RPF+ + +LC AF +YLD+L++E                     K+ ILK HPDLAGRLAA+ ELT+ES  EQRSAGL DLT EQ+ TI  +NERYKSKFGFPFIICARENKVQSII GLQ RYN+SREQEI TGINEVKKIC+LRI DIV+ +
Sbjct:    5 EFQRVFGNVIELCESAAVSVKDTRPFKGLPDLCAAFNKYLDDLNLEGDKVMLQQLLGKVTIPKHVMGKIEILKSHPDLAGRLAARNELTRESANEQRSAGLTDLTFEQKSTIEVNNERYKSKFGFPFIICARENKVQSIIEGLQRRYNNSREQEIITGINEVKKICRLRILDIVRSE 181          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|156550817|ref|XP_001600870.1| (PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Nasonia vitripennis])

HSP 1 Score: 203.371 bits (516), Expect = 6.451e-64
Identity = 98/175 (56.00%), Postives = 130/175 (74.29%), Query Frame = 0
Query:    1 MASK--IRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVKDD 173
            M SK  + +SEVN L  E FEW+F NV+E C +AA  V  KRPF    +L +AF+EYL+ L   EK ++L  HPDLAG+LA  G+LT ES+ EQ+ AGL+ +T++ R T++N+N  YK KF FPFIICAR+NKVQSI+SGL++R N+SRE E+ TGI+EVKKIC++RI D+V  D
Sbjct:    1 MTSKGILSISEVNALPAENFEWLFANVIEHCPEAAPIVATKRPFSSTEDLKRAFDEYLEKLDTNEKELVLLKHPDLAGKLAEDGKLTAESQNEQKIAGLDTMTKDDRQTLSNNNYLYKEKFRFPFIICARQNKVQSILSGLETRLNNSRETELKTGIDEVKKICRVRIDDLVWPD 175          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|512913171|ref|XP_004927832.1| (PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Bombyx mori])

HSP 1 Score: 199.519 bits (506), Expect = 2.107e-62
Identity = 97/173 (56.07%), Postives = 123/173 (71.10%), Query Frame = 0
Query:    1 MASKIRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVKDD 173
            M+  + +S+VN L  E+FE++F NV+EL   AA +V KKRPF +  ELC AF+ YL+ LS  EK  + K HPDLAG+++  GELT ES +EQ SAGLN L  EQ+  IN+ NE YK KFGFPFI+CARENKV SI+ GLQ R  +S  QE  T +NEVKKIC+ RI DIV ++
Sbjct:    9 MSFLLNISQVNALSDERFEYVFRNVIELYPAAAIEVGKKRPFNNSTELCAAFDNYLEELSTAEKNKVFKFHPDLAGKISQMGELTPESTKEQNSAGLNQLNSEQKSLINHYNESYKEKFGFPFIVCARENKVASILEGLQIRLKNSSFQEYQTALNEVKKICRYRIYDIVDEN 181          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|914555811|gb|KOB65437.1| (Uncharacterized protein OBRU01_22748 [Operophtera brumata])

HSP 1 Score: 194.512 bits (493), Expect = 1.229e-60
Identity = 98/172 (56.98%), Postives = 126/172 (73.26%), Query Frame = 0
Query:    1 MASKIRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVKD 172
            M  K+ VS VN L  ++FE  F NV+ELC DAA +V++ RPF+  +E+  AF +YL+ ++ E          DLAGRLAA+G+LTKES  EQRSAGL++LT      ++ SN+RYK KFGFPFIICARENKV+SII+GLQ+RY+++ EQEI TGI EVKKIC LRI DI+ D
Sbjct:    1 MPPKLSVSNVNSLQEDEFEEAFCNVIELCPDAAKRVKRLRPFKGTSEISAAFCQYLEGINAE----------DLAGRLAARGQLTKESTDEQRSAGLHELTAADNKLMDESNQRYKEKFGFPFIICARENKVESIIAGLQARYHNTYEQEIKTGIEEVKKICTLRINDIMSD 162          
BLAST of HiSeq12059 vs. genbank:protein
Match: gi|998507113|ref|XP_015513860.1| (PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Neodiprion lecontei] >gi|998507115|ref|XP_015513861.1| PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase-like [Neodiprion lecontei])

HSP 1 Score: 190.66 bits (483), Expect = 5.531e-59
Identity = 90/169 (53.25%), Postives = 121/169 (71.60%), Query Frame = 0
Query:    5 IRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCKAFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDLTEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQEIYTGINEVKKICKLRIQDIVKDD 173
            + + EVN L  EQFEW+FGNV+E C +AA  V  KRPF     L  AF++YLD L   EK  +L  HPDLAG+LA +G+LT ES+ EQ+ AGL+++T E++ T+ N N  YK KF FPF+ICARENKV +I+SG+++R N+S E E+  GI EVKKIC++R+ D+V  D
Sbjct:    7 LSILEVNALPTEQFEWLFGNVIEHCPEAAGWVATKRPFLSTESLRNAFDDYLDKLKNHEKENVLIKHPDLAGKLAEEGKLTTESQNEQKCAGLDEMTREEKQTLANLNAMYKEKFHFPFVICARENKVAAILSGIENRLNNSPETELEVGIQEVKKICRIRLLDVVWSD 175          
The following BLAST results are available for this feature:
BLAST of HiSeq12059 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|768435024|ref|XP_011558937.1|1.634e-8371.35PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimida... [more]
gi|913310072|ref|XP_013185654.1|1.449e-8171.86PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimida... [more]
gi|943944422|ref|XP_014355562.1|2.857e-7765.29PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimida... [more]
gi|910343384|ref|XP_013175457.1|2.052e-7665.48PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimida... [more]
gi|909559568|ref|XP_013134844.1|3.356e-7563.16PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimida... [more]
gi|357603793|gb|EHJ63921.1|9.288e-6961.58hypothetical protein KGM_05096 [Danaus plexippus][more]
gi|156550817|ref|XP_001600870.1|6.451e-6456.00PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimida... [more]
gi|512913171|ref|XP_004927832.1|2.107e-6256.07PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimida... [more]
gi|914555811|gb|KOB65437.1|1.229e-6056.98Uncharacterized protein OBRU01_22748 [Operophtera ... [more]
gi|998507113|ref|XP_015513860.1|5.531e-5953.25PREDICTED: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimida... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0019428 allantoin biosynthetic process
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018020Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylasePFAMPF09349OHCU_decarboxcoord: 10..168
e-value: 3.5E-42
score: 144.2
IPR018020Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylaseGENE3D1.10.3330.10coord: 13..172
e-value: 2.5E-47
score: 160.6
IPR0175802-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase, type 1TIGRFAMTIGR03164TIGR03164coord: 15..169
e-value: 2.0E-39
score: 133.2
NoneNo IPR availablePANTHERPTHR10395URICASE AND TRANSTHYRETIN-RELATEDcoord: 1..170
NoneNo IPR availablePANTHERPTHR10395:SF14SUBFAMILY NOT NAMEDcoord: 1..170
NoneNo IPR availableSUPERFAMILY158694UraD-Likecoord: 7..170

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12059HiSeq12059Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12059_p ID=HiSeq12059_p|Name=HiSeq12059|organism=Ostrinia scapulalis|type=polypeptide|length=173bp
MASKIRVSEVNKLDGEQFEWMFGNVVELCTDAAAQVQKKRPFQDVAELCK
AFEEYLDNLSIEEKVVILKLHPDLAGRLAAQGELTKESKQEQRSAGLNDL
TEEQRFTINNSNERYKSKFGFPFIICARENKVQSIISGLQSRYNSSREQE
IYTGINEVKKICKLRIQDIVKDD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0019428allantoin biosynthetic process
Vocabulary: INTERPRO
TermDefinition
IPR017580OHCU_decarboxylase-1
IPR018020OHCU_decarboxylase