HiSeq12063_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12063
Unique NameHiSeq12063_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length526
Homology
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|827553326|ref|XP_012548359.1| (PREDICTED: mitochondrial sodium/hydrogen exchanger 9B2-like [Bombyx mori])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 361/520 (69.42%), Postives = 424/520 (81.54%), Query Frame = 0
Query:    8 DRPDIQNGRSN-VISFEVKPFXXREKQLEQNGYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEV-SQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLWDTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHGLPSAKHLS-----RRNTVPGSL 520
            D+ D  N R N   +FE+     ++KQ  +          +PSL E KQY+GVLICGLTLWGTSWF+FKDAV+PG +IFNM+GVVIAGY FGH LER+TT+NPVVGMT +GALYRNLGP +FL+N  A+ IDFHLRRIYPVIILTKGPLSWNWEYIKNN +KVFSLATLPW++ECLSTAF +H+LL + W WGLHLGAILSSVSPA++VPTV++   RG GTK +IALLVGNAGGLDTAFTEG+FG+ NSAIFY++SL Y+IIK +LA+FVGI LGI+WGVL D +PD  D YAP VRSLLIF GG L+TYAGGY GWGGTSGVAIMVCAG AATRWSRR WPIN+NPVSEVYK+LWRI EPMLFTLSGYFL+V SQ++ ++F LI+GCI++AL  R+LTAFLV LAN LS+KES+FV+VTWIPKAIVEAVLVRVA DS+   AS  DKR AAQHANIIVIAI+ITST GSVLTT LGP+LLS +SR++P + Y++  L  A         RRN  P +L
Sbjct:    8 DQND--NIRQNKATTFEIGFKTRQDKQKGRESILIKLLSAIPSLVETKQYIGVLICGLTLWGTSWFLFKDAVLPGSYIFNMSGVVIAGYCFGHALERFTTINPVVGMTFMGALYRNLGPTNFLENSTANSIDFHLRRIYPVIILTKGPLSWNWEYIKNNPVKVFSLATLPWIIECLSTAFLAHILLNYQWKWGLHLGAILSSVSPALIVPTVVALKERGLGTKHEIALLVGNAGGLDTAFTEGIFGVTNSAIFYEASLTYKIIKGLLAIFVGICLGIAWGVLCDVIPDHNDLYAPTVRSLLIFGGGMLVTYAGGYLGWGGTSGVAIMVCAGVAATRWSRRGWPINDNPVSEVYKLLWRIFEPMLFTLSGYFLDVSSQLNTKEFCLIIGCIISALFLRMLTAFLVGLANNLSIKESVFVSVTWIPKAIVEAVLVRVAADSILSDASEEDKRTAAQHANIIVIAILITSTAGSVLTTALGPILLSQDSRISPGDFYRAQTLSPASSFHDSSQIRRNNAPSTL 525          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|913302478|ref|XP_013200419.1| (PREDICTED: mitochondrial sodium/hydrogen exchanger 9B2-like [Amyelois transitella])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 345/509 (67.78%), Postives = 410/509 (80.55%), Query Frame = 0
Query:    8 DRPDIQNGRSNVISFEVKPFXXREKQ-LEQNGYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLWDTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHGL-PSAKHLSRRN 514
            +R +      NV +FE+ P      Q  E           +PSL+E KQY GVL+CGLT+WGTSW   KD V+PGGF F+M GV IAGYV GHTLERY+T+NPVVGMT+ GALYR+ GP S+L++P+A+ IDFHLRRIYPVIILTKGPL+WNW+YI+ NS+KVFSLATLPW+VEC ST FFSHLLL FPWYWGLHLGAIL+SVSPAVVVPTV + SARG GTK QIA LVGNAGGLDTAFTEGMFG+INSAIF+ + L Y+I+KAVLA+F+GI LGI WG+L D+VPD  D YAP +RSLLIF GG L++Y   YFGWGGTSGVAIMVCAG AATRWSRR W IN+NPV+EVYK+LWRI EPMLFT SGYFLE+S  S ++  L++ CI +AL  RL+TAFL+ + N++S+KESLF+AVTWIPKAIVEAVLVRVA DSLW  A+  DK++A+QH+NIIVIAI+ITSTLGS LTT LGP+LL SES+VAPEE Y++  L P A   S R+
Sbjct:    6 ERNNTDTRTYNVTTFEIGPNKTNIPQTYEHKVLKSRIKKAIPSLHEWKQYFGVLLCGLTIWGTSWLALKDVVLPGGFAFHMAGVAIAGYVCGHTLERYSTINPVVGMTLTGALYRSFGPASYLEDPIANSIDFHLRRIYPVIILTKGPLTWNWDYIRKNSIKVFSLATLPWIVECTSTVFFSHLLLDFPWYWGLHLGAILASVSPAVVVPTVNALSARGLGTKQQIAQLVGNAGGLDTAFTEGMFGVINSAIFFPALLPYKIVKAVLAMFLGIVLGILWGILIDYVPDHSDFYAPTIRSLLIFCGGLLISYGSAYFGWGGTSGVAIMVCAGTAATRWSRRGWAINDNPVAEVYKLLWRIFEPMLFTYSGYFLEISYTSAKEISLMVACIFSALILRLITAFLIGICNKMSIKESLFIAVTWIPKAIVEAVLVRVAMDSLWSDATSFDKQIASQHSNIIVIAILITSTLGSSLTTFLGPILL-SESKVAPEEFYRTQTLSPPASSNSVRD 513          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|357626264|gb|EHJ76413.1| (hypothetical protein KGM_09848 [Danaus plexippus])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 327/524 (62.40%), Postives = 411/524 (78.44%), Query Frame = 0
Query:    3 GNCEPDRPDIQNGRSNVISFEVK-PFXXREKQLEQNGYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSL-WDTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHGLPSAKHLSRRNTVPGSLHRVD 524
             N   +  D   G+++V++++       R  + +    C     T P + E+KQY+GV+ CGL LWG+SWF+F+D V+PGG++F M  +V++GY FGHTLER+T +NPVVGMT+VG  +R     +FL NP+AD IDFHLRRIYPVIILTKGPL+WNW+YIKNNS+KVFSLATLPW+VECLSTA  +HLLLGFPW+WG+HLG+ILSSVSPAV+VPT ++ S++G G K+QIALLV NAGGLDTAFTEGMFGIINSAIFY S  +YRI+KA+LA+FVGI LG  W +  D++PD  D YAP VRSLLIFAGG  +TY  GY GWGG+SGVAIM+CAG+AATRW+RRDWP+NNNPVSEVYK+LW I EPMLF+LSGYFLEVSQ++V++FGLI+ CI +AL  R++TA LV L N L+ KESLF+A+TW+PKAIVEAVLVRVA DSL  D+A+  DK +A  H+ IIVIAII TSTLGSVLTT LGP+LLS +++VAP E  Q+        ++R N +  S  R++
Sbjct:    2 ANYRVNDDDSPEGKTSVLTYDTSFSQTNRSPKSKAKLLCIKLCSTFPFVPELKQYVGVITCGLLLWGSSWFLFEDDVLPGGYLFEMGALVVSGYSFGHTLERFTRLNPVVGMTLVGVTWRYFSSTNFLKNPIADSIDFHLRRIYPVIILTKGPLTWNWQYIKNNSIKVFSLATLPWIVECLSTAVLTHLLLGFPWHWGIHLGSILSSVSPAVIVPTTVALSSKGLGLKNQIALLVANAGGLDTAFTEGMFGIINSAIFYPSEPVYRIVKAILAIFVGIGLGSVWAIFVDYIPDHKDFYAPTVRSLLIFAGGLFITYVSGYLGWGGSSGVAIMICAGSAATRWARRDWPLNNNPVSEVYKLLWTIFEPMLFSLSGYFLEVSQITVQEFGLIVACIFSALFIRMITALLVALVNNLTFKESLFIAITWMPKAIVEAVLVRVAVDSLPSDSATAHDKWIATHHSKIIVIAIIFTSTLGSVLTTALGPILLSRDTKVAPMEEPQTLSSCQGDDIARTNNILKSPCRIE 525          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|943950897|ref|XP_014358400.1| (PREDICTED: mitochondrial sodium/hydrogen exchanger 9B2-like isoform X2 [Papilio machaon])

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 336/519 (64.74%), Postives = 415/519 (79.96%), Query Frame = 0
Query:   12 IQNGRSNVISFEVKPFXXREKQLEQN---GYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLW-DTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHG--LPSAKHLSRRNTVPGSLHRVD 524
            ++  + + IS  +     REK+L+ N    +       LP+  E+KQY GV++ G+TLW TSWFIF++AV+PG  IFN+  +V AGYVFGHTLERYTT+N + GMT+VGAL++  G  +F DNP+AD ID++LRR+YP++ILTKGPL WNW YIKNNS+KVF LATLPW+VECLSTA F+HLLL +PWYWG+HLGAILSSVSPAVVVPTVM+ +A+  GTK++IALLV NAGGLDTAFTEGMFG+INSAIFY S   YRI+KA+LA+FVGI LGI WG+L D +PD  DP+A  VRSLLIFAGG LLTYAGGY GWGGTSGVAIMVCAG AATRW+RRDWPINNNPV+ VYKVLW I EPMLFTLSGYFLEV+Q+++++ GLI+ C+  AL  RL+ AFL+ + N LS+KESLF+AVTWIPKAIVEAVLVRVATDSLW D A+ +DK++A QHANII+IAI+I +TLGS LTT+LGPVLLS +S++   E +Q+       A  ++RR     S+H +D
Sbjct:    1 MKARKQSKISIRILKAPKREKRLDANQKSNFAFKLLDILPTKRELKQYTGVILFGITLWATSWFIFQEAVLPGSSIFNLIAMVAAGYVFGHTLERYTTINAMAGMTLVGALFKIFGHTNFFDNPIADTIDYNLRRLYPIVILTKGPLGWNWPYIKNNSMKVFLLATLPWIVECLSTAIFTHLLLEYPWYWGVHLGAILSSVSPAVVVPTVMAFNAKSLGTKNKIALLVANAGGLDTAFTEGMFGVINSAIFYPSPPAYRIVKALLAIFVGIGLGIGWGILCDILPDHKDPFAATVRSLLIFAGGLLLTYAGGYLGWGGTSGVAIMVCAGTAATRWARRDWPINNNPVATVYKVLWLIFEPMLFTLSGYFLEVTQLTLKELGLIVACLFLALLMRLVAAFLISIVNRLSIKESLFIAVTWIPKAIVEAVLVRVATDSLWKDGATEQDKKIAKQHANIIIIAILIMTTLGSGLTTILGPVLLSQDSKIRDREFHQTPSPIQSQAYDVTRRKNTSTSVHFMD 519          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|930674870|gb|KPJ15201.1| (Sodium/hydrogen exchanger-like domain-containing protein 1 [Papilio machaon])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 338/530 (63.77%), Postives = 416/530 (78.49%), Query Frame = 0
Query:    1 MAGNCEPDRPDIQNGRSNVISFEVKPFXXREKQLEQN---GYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLW-DTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHG--LPSAKHLSRRNTVPGSLHRVD 524
            ++G C     D    R+  + F   P     K+L+ N    +       LP+  E+KQY GV++ G+TLW TSWFIF++AV+PG  IFN+  +V AGYVFGHTLERYTT+N + GMT+VGAL++  G  +F DNP+AD ID++LRR+YP++ILTKGPL WNW YIKNNS+KVF LATLPW+VECLSTA F+HLLL +PWYWG+HLGAILSSVSPAVVVPTVM+ +A+  GTK++IALLV NAGGLDTAFTEGMFG+INSAIFY S   YRI+KA+LA+FVGI LGI WG+L D +PD  DP+A  VRSLLIFAGG LLTYAGGY GWGGTSGVAIMVCAG AATRW+RRDWPINNNPV+ VYKVLW I EPMLFTLSGYFLEV+Q+++++ GLI+ C+  AL  RL+ AFL+ + N LS+KESLF+AVTWIPKAIVEAVLVRVATDSLW D A+ +DK++A QHANII+IAI+I +TLGS LTT+LGPVLLS +S++   E +Q+       A  ++RR     S+H +D
Sbjct:   34 VSGGCR----DANCPRAVALPFAESPPAAVAKRLDANQKSNFAFKLLDILPTKRELKQYTGVILFGITLWATSWFIFQEAVLPGSSIFNLIAMVAAGYVFGHTLERYTTINAMAGMTLVGALFKIFGHTNFFDNPIADTIDYNLRRLYPIVILTKGPLGWNWPYIKNNSMKVFLLATLPWIVECLSTAIFTHLLLEYPWYWGVHLGAILSSVSPAVVVPTVMAFNAKSLGTKNKIALLVANAGGLDTAFTEGMFGVINSAIFYPSPPAYRIVKALLAIFVGIGLGIGWGILCDILPDHKDPFAATVRSLLIFAGGLLLTYAGGYLGWGGTSGVAIMVCAGTAATRWARRDWPINNNPVATVYKVLWLIFEPMLFTLSGYFLEVTQLTLKELGLIVACLFLALLMRLVAAFLISIVNRLSIKESLFIAVTWIPKAIVEAVLVRVATDSLWKDGATEQDKKIAKQHANIIIIAILIMTTLGSGLTTILGPVLLSQDSKIRDREFHQTPSPIQSQAYDVTRRKNTSTSVHFMD 559          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|943950894|ref|XP_014358399.1| (PREDICTED: mitochondrial sodium/hydrogen exchanger 9B2-like isoform X1 [Papilio machaon])

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 336/519 (64.74%), Postives = 412/519 (79.38%), Query Frame = 0
Query:   13 QNGRSNVISFEVKPF-XXREKQLEQN---GYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLW-DTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHG--LPSAKHLSRRNTVPGSLHRVD 524
            +N     I    K F   + K+L+ N    +       LP+  E+KQY GV++ G+TLW TSWFIF++AV+PG  IFN+  +V AGYVFGHTLERYTT+N + GMT+VGAL++  G  +F DNP+AD ID++LRR+YP++ILTKGPL WNW YIKNNS+KVF LATLPW+VECLSTA F+HLLL +PWYWG+HLGAILSSVSPAVVVPTVM+ +A+  GTK++IALLV NAGGLDTAFTEGMFG+INSAIFY S   YRI+KA+LA+FVGI LGI WG+L D +PD  DP+A  VRSLLIFAGG LLTYAGGY GWGGTSGVAIMVCAG AATRW+RRDWPINNNPV+ VYKVLW I EPMLFTLSGYFLEV+Q+++++ GLI+ C+  AL  RL+ AFL+ + N LS+KESLF+AVTWIPKAIVEAVLVRVATDSLW D A+ +DK++A QHANII+IAI+I +TLGS LTT+LGPVLLS +S++   E +Q+       A  ++RR     S+H +D
Sbjct:    9 RNESKETIKNFYKDFESAKTKRLDANQKSNFAFKLLDILPTKRELKQYTGVILFGITLWATSWFIFQEAVLPGSSIFNLIAMVAAGYVFGHTLERYTTINAMAGMTLVGALFKIFGHTNFFDNPIADTIDYNLRRLYPIVILTKGPLGWNWPYIKNNSMKVFLLATLPWIVECLSTAIFTHLLLEYPWYWGVHLGAILSSVSPAVVVPTVMAFNAKSLGTKNKIALLVANAGGLDTAFTEGMFGVINSAIFYPSPPAYRIVKALLAIFVGIGLGIGWGILCDILPDHKDPFAATVRSLLIFAGGLLLTYAGGYLGWGGTSGVAIMVCAGTAATRWARRDWPINNNPVATVYKVLWLIFEPMLFTLSGYFLEVTQLTLKELGLIVACLFLALLMRLVAAFLISIVNRLSIKESLFIAVTWIPKAIVEAVLVRVATDSLWKDGATEQDKKIAKQHANIIIIAILIMTTLGSGLTTILGPVLLSQDSKIRDREFHQTPSPIQSQAYDVTRRKNTSTSVHFMD 527          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|909557231|ref|XP_013133578.1| (PREDICTED: mitochondrial sodium/hydrogen exchanger 9B2-like isoform X1 [Papilio polytes])

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 333/523 (63.67%), Postives = 416/523 (79.54%), Query Frame = 0
Query:    8 DRPDIQNGRSNVISFEVKPFXXREKQLEQN---GYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLW-DTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHG--LPSAKHLSRRNTVPGSLHRVD 524
            D  +    +  + +F +     + K+LE+N   G+       LPS  E+KQY+GV++ G+ LW T WF+F++AV+PG  IFN++ +V AGY FGHTLERYTT+N + GMT+VG L++  G  +F+D+P+AD ID+HLRRIYPV+ILTKGPL WNW YI+NNS+KVF LATLPW+VECLSTA F+H+LL +PWYWG+HLGAIL+SVSPAVVVPTVM+ +A+G GTK++IALLV NAGGLDTAFTEGMFG+INSAIFY S   YRI+KA+LA+FVGI +GI WG+L D +PD  DPYA  VRSLLIFAGG LLTYAGGY GWGGTSGVAIM+CAG AATRW+RRDWPIN+NPV+ VYKVLW I EPMLFTLSGYFLEV+++++ D GLI+GC+  AL  RL+ AFL+ +AN LSVKESLFVAVTWIPKAIVEAVLVRVATDSLW D A+ +DK +A QH NII+IAI+I ++LGS LTT+LGPVLLS +S++   E +Q+     P A  ++RR     S+H +D
Sbjct:    5 DGIERNESKETIKNFYLDFESAKTKRLEENQNKGFVFKLLDILPSKRELKQYIGVILFGIILWATLWFVFQEAVMPGSSIFNLSVMVAAGYAFGHTLERYTTINAMAGMTLVGVLFKIFGNTNFIDDPIADTIDYHLRRIYPVLILTKGPLGWNWPYIRNNSMKVFLLATLPWIVECLSTAIFTHVLLEYPWYWGIHLGAILASVSPAVVVPTVMAFNAKGLGTKNKIALLVANAGGLDTAFTEGMFGVINSAIFYPSPPAYRIVKALLAIFVGIGIGIGWGILCDVLPDHKDPYAATVRSLLIFAGGLLLTYAGGYLGWGGTSGVAIMICAGTAATRWARRDWPINDNPVATVYKVLWLIFEPMLFTLSGYFLEVAELTLVDLGLIVGCLFLALLMRLMAAFLISVANSLSVKESLFVAVTWIPKAIVEAVLVRVATDSLWKDGATEQDKGIAKQHGNIIIIAILIMTSLGSCLTTILGPVLLSQDSKIRDSEFHQTPSPIQPQAYDVTRRKNTNTSVHFID 527          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|910354052|ref|XP_013181071.1| (PREDICTED: sodium/hydrogen exchanger 9B1-like [Papilio xuthus])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 330/519 (63.58%), Postives = 413/519 (79.58%), Query Frame = 0
Query:    9 RPDIQNGRSNVISFEVKPFXXREKQLEQNGYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLW-DTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHGLPSAK--HLSRRNTVPGSLHRVD 524
            +  I+N   +  S + K    R    ++  +       LP+  E+KQY+GV++ G+TLW TSWF+F++AV+PG  IFN+  +V  GYVFGHTLERYTT+N + GMT+VGAL++  G  +F+DNPV + ID+HLRRIYPV+ILTKGPL WNW YIKNNS+KVF LATLPW+VECLSTA F+H+LL +PWYWG+HLGAILSSVSPAVVVPTVM+ SA+G GTK++IALLV NAGGLDTAFTEGMFG+INSAIFY S   YRI+KA+LA+FVGI LGI WG+L D +PD  DP+A  VRSLLIFAGG LLTYAGGY GWGGTSGVAIMVCAG AATRW+RRDWPIN+NPV+ VYKVLW I EPMLFTLSGYFLEV+++++++ GLI+ C+  AL  RL+ AFL+ + N LS+KESLF+AVTWIPKAIVEAVLVRVATDSLW D A+ +DK++A QHANII+IAI+I ++LGS LTT+LGPVLLS + ++   E +Q+     ++   ++RR     S+H +D
Sbjct:   13 KETIKNFYQDFESAKTK----RLDATQKTNFAFKLLDILPTKRELKQYIGVILFGITLWATSWFVFQEAVLPGSSIFNLAAMVAVGYVFGHTLERYTTINAMAGMTLVGALFKIFGQTNFIDNPVTNTIDYHLRRIYPVLILTKGPLGWNWPYIKNNSMKVFLLATLPWIVECLSTAIFTHVLLEYPWYWGVHLGAILSSVSPAVVVPTVMAFSAKGLGTKNKIALLVANAGGLDTAFTEGMFGVINSAIFYPSPPAYRIVKALLAIFVGIGLGIGWGILCDILPDHKDPFAATVRSLLIFAGGLLLTYAGGYLGWGGTSGVAIMVCAGTAATRWARRDWPINDNPVATVYKVLWLIFEPMLFTLSGYFLEVTELTLKELGLIVACLFLALIMRLVAAFLISILNRLSIKESLFIAVTWIPKAIVEAVLVRVATDSLWKDGATEQDKKIAKQHANIIIIAILIMTSLGSGLTTILGPVLLSQDFKIRDSEFHQTPSPIQSQVYDVTRRKNTNTSVHFMD 527          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|930651538|gb|KPI93881.1| (Sodium/hydrogen exchanger-like domain-containing protein 1 [Papilio xuthus])

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 324/490 (66.12%), Postives = 399/490 (81.43%), Query Frame = 0
Query:    8 DRPDIQNGRSNVISFEVKPFXXREKQLEQN---GYCGIFTPTLPSLNEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLW-DTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRV 493
            D  +  + +  + +F       + K+L+ N    +       LP+  E KQY+GV++ G+TLW TSWF+F++AV+PG  IFN+  +V  GYVFGHTLERYTT+N + GMT+VGAL++  G  +F+DNPV + ID+HLRRIYPV+ILTKGPL WNW YIKNNS+KVF LATLPW+VECLSTA F+H+LL +PWYWG+HLGAILSSVSPAVVVPTVM+ SA+G GTK++IALLV NAGGLDTAFTEGMFG+INSAIFY S   YRI+KA+LA+FVGI LGI WG+L D +PD  DP+A  VRSLLIFAGG LLTYAGGY GWGGTSGVAIMVCAG AATRW+RRDWPIN+NPV+ VYKVLW I EPMLFTLSGYFLEVS++++++ GLI+ C+  AL  RL+ AFL+ + N LS+KESLF+AVTWIPKAIVEAVLVRVATDSLW D A+ +DK++A QHANII+IAI+I ++LGS LTT+LGPVLLS + ++
Sbjct:    5 DGIERNDSKETIKNFYQDFESAKTKRLDANQKSNFAFKLLDILPTKREFKQYIGVILFGITLWATSWFVFQEAVLPGSSIFNLAAMVAVGYVFGHTLERYTTINAMAGMTLVGALFKIFGQTNFIDNPVTNTIDYHLRRIYPVLILTKGPLGWNWPYIKNNSMKVFLLATLPWIVECLSTAIFTHVLLEYPWYWGVHLGAILSSVSPAVVVPTVMAFSAKGLGTKNKIALLVANAGGLDTAFTEGMFGVINSAIFYPSPPAYRIVKALLAIFVGIGLGIGWGILCDILPDHKDPFAATVRSLLIFAGGLLLTYAGGYLGWGGTSGVAIMVCAGTAATRWARRDWPINDNPVATVYKVLWLIFEPMLFTLSGYFLEVSELTLKELGLIVACLFLALIMRLVAAFLISILNRLSIKESLFIAVTWIPKAIVEAVLVRVATDSLWKDGATEQDKKIAKQHANIIIIAILIMTSLGSGLTTILGPVLLSQDFKI 494          

HSP 2 Score: 268.085 bits (684), Expect = 6.131e-76
Identity = 183/464 (39.44%), Postives = 255/464 (54.96%), Query Frame = 0
Query:   55 QYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSL--WDTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHGLPSAKHLSRRNTV 516
             YL + + G+  WG  W  F D     G  F +  V    +  G  L+  TT+ P++   + G   R+ G   FLD      ID  LR+IYPVIIL KG L+W+ +Y+KNN  +V SL TLPW  E +  A  SH  LGFPW WG  LG++ +SVS  V++P +  H  +   +++    LV  AGG DTA + G+FG+I S +F  +S +YR IKA LA+  G ALG  WG LA  +P   D Y   +R L +  GG    +     GWGGT G+A++ C   AA +W+R+ W +N+NP +  Y+VLW   EP+LF  +G F  +         L LG ++  L+ RLL A LVC    LS+KE LF+   WIPK+IVEAVL  +A D+L   D+      + A     ++V AI+IT+ +G +LT  LGPVLL S+S+           L S K  SR  ++
Sbjct:  554 HYLTLGVIGILTWGLLWCAFDDDWGWDGKWFRLGAVATVAWASGLVLQELTTLPPLLAALLTGIFARHFG---FLDMRHYSHIDAFLRKIYPVIILGKGSLAWDMDYMKNNWKQVVSLGTLPWSAEVVVMALCSHYFLGFPWLWGFLLGSVYASVSCPVIMPLIQRHGTKPDRSQNW-PQLVCTAGGTDTALSVGVFGLIFSFMFSNASDLYRYIKAGLALLAGAALGGGWGALARLLPHARDAYVTELRILFVLVGGLFANFFTAALGWGGTGGIAVLACNATAARQWARKGWKLNHNPAATAYRVLWSACEPVLFAYTGTFFVIHSSVTDTMLLGLGILLITLTTRLLIAALVCW--NLSIKEKLFICCAWIPKSIVEAVLCPLAIDTLIMKDSDDDHQMKYAEDLMRLVVQAILITTPIGYLLTNHLGPVLLKSKSK-------NDKDLESHKRTSRDTSI 1004          
BLAST of HiSeq12063 vs. genbank:protein
Match: gi|909557233|ref|XP_013133579.1| (PREDICTED: mitochondrial sodium/hydrogen exchanger 9B2-like isoform X2 [Papilio polytes])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 308/449 (68.60%), Postives = 374/449 (83.30%), Query Frame = 0
Query:   79 IPGGFIFNMTGVVIAGYVFGHTLERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIILTKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGLHLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGMFGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYAPAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPINNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALSFRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLW-DTASPRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQSHG--LPSAKHLSRRNTVPGSLHRVD 524
            +PG  IFN++ +V AGY FGHTLERYTT+N + GMT+VG L++  G  +F+D+P+AD ID+HLRRIYPV+ILTKGPL WNW YI+NNS+KVF LATLPW+VECLSTA F+H+LL +PWYWG+HLGAIL+SVSPAVVVPTVM+ +A+G GTK++IALLV NAGGLDTAFTEGMFG+INSAIFY S   YRI+KA+LA+FVGI +GI WG+L D +PD  DPYA  VRSLLIFAGG LLTYAGGY GWGGTSGVAIM+CAG AATRW+RRDWPIN+NPV+ VYKVLW I EPMLFTLSGYFLEV+++++ D GLI+GC+  AL  RL+ AFL+ +AN LSVKESLFVAVTWIPKAIVEAVLVRVATDSLW D A+ +DK +A QH NII+IAI+I ++LGS LTT+LGPVLLS +S++   E +Q+     P A  ++RR     S+H +D
Sbjct:    1 MPGSSIFNLSVMVAAGYAFGHTLERYTTINAMAGMTLVGVLFKIFGNTNFIDDPIADTIDYHLRRIYPVLILTKGPLGWNWPYIRNNSMKVFLLATLPWIVECLSTAIFTHVLLEYPWYWGIHLGAILASVSPAVVVPTVMAFNAKGLGTKNKIALLVANAGGLDTAFTEGMFGVINSAIFYPSPPAYRIVKALLAIFVGIGIGIGWGILCDVLPDHKDPYAATVRSLLIFAGGLLLTYAGGYLGWGGTSGVAIMICAGTAATRWARRDWPINDNPVATVYKVLWLIFEPMLFTLSGYFLEVAELTLVDLGLIVGCLFLALLMRLMAAFLISVANSLSVKESLFVAVTWIPKAIVEAVLVRVATDSLWKDGATEQDKGIAKQHGNIIIIAILIMTSLGSCLTTILGPVLLSQDSKIRDSEFHQTPSPIQPQAYDVTRRKNTNTSVHFID 449          
The following BLAST results are available for this feature:
BLAST of HiSeq12063 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|827553326|ref|XP_012548359.1|0.000e+069.42PREDICTED: mitochondrial sodium/hydrogen exchanger... [more]
gi|913302478|ref|XP_013200419.1|0.000e+067.78PREDICTED: mitochondrial sodium/hydrogen exchanger... [more]
gi|357626264|gb|EHJ76413.1|0.000e+062.40hypothetical protein KGM_09848 [Danaus plexippus][more]
gi|943950897|ref|XP_014358400.1|0.000e+064.74PREDICTED: mitochondrial sodium/hydrogen exchanger... [more]
gi|930674870|gb|KPJ15201.1|0.000e+063.77Sodium/hydrogen exchanger-like domain-containing p... [more]
gi|943950894|ref|XP_014358399.1|0.000e+064.74PREDICTED: mitochondrial sodium/hydrogen exchanger... [more]
gi|909557231|ref|XP_013133578.1|0.000e+063.67PREDICTED: mitochondrial sodium/hydrogen exchanger... [more]
gi|910354052|ref|XP_013181071.1|0.000e+063.58PREDICTED: sodium/hydrogen exchanger 9B1-like [Pap... [more]
gi|930651538|gb|KPI93881.1|6.131e-7666.12Sodium/hydrogen exchanger-like domain-containing p... [more]
gi|909557233|ref|XP_013133579.1|0.000e+068.60PREDICTED: mitochondrial sodium/hydrogen exchanger... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006812 cation transport
biological_process GO:1902600 hydrogen ion transmembrane transport
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0015299 solute:proton antiporter activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006153Cation/H+ exchangerPFAMPF00999Na_H_Exchangercoord: 94..481
e-value: 3.5E-17
score: 61.8
NoneNo IPR availablePANTHERPTHR31102FAMILY NOT NAMEDcoord: 47..520
NoneNo IPR availablePANTHERPTHR31102:SF1GH07323Pcoord: 47..520
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 220..267
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 488..526
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 56..74
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 75..79
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 193..197
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..55
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 288..306
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 361..378
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 80..98
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 442..460
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 421..441
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 461..487
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 307..340
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 410..420
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 341..360
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 198..219
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 169..192
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 390..409
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 379..389
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 99..168
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 268..287
NoneNo IPR availableTMHMMTMhelixcoord: 463..485
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 56..73
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 420..442
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
NoneNo IPR availableTMHMMTMhelixcoord: 77..99

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12063HiSeq12063Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12063_p ID=HiSeq12063_p|Name=HiSeq12063|organism=Ostrinia scapulalis|type=polypeptide|length=526bp
MAGNCEPDRPDIQNGRSNVISFEVKPFXXREKQLEQNGYCGIFTPTLPSL
NEVKQYLGVLICGLTLWGTSWFIFKDAVIPGGFIFNMTGVVIAGYVFGHT
LERYTTVNPVVGMTVVGALYRNLGPPSFLDNPVADIIDFHLRRIYPVIIL
TKGPLSWNWEYIKNNSLKVFSLATLPWLVECLSTAFFSHLLLGFPWYWGL
HLGAILSSVSPAVVVPTVMSHSARGFGTKSQIALLVGNAGGLDTAFTEGM
FGIINSAIFYQSSLIYRIIKAVLAVFVGIALGISWGVLADFVPDQGDPYA
PAVRSLLIFAGGFLLTYAGGYFGWGGTSGVAIMVCAGAAATRWSRRDWPI
NNNPVSEVYKVLWRILEPMLFTLSGYFLEVSQMSVRDFGLILGCIVAALS
FRLLTAFLVCLANELSVKESLFVAVTWIPKAIVEAVLVRVATDSLWDTAS
PRDKRVAAQHANIIVIAIIITSTLGSVLTTVLGPVLLSSESRVAPEEVYQ
SHGLPSAKHLSRRNTVPGSLHRVDVQ
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0055085transmembrane transport
GO:0006812cation transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0015299solute:proton antiporter activity
Vocabulary: INTERPRO
TermDefinition
IPR006153Cation/H_exchanger