HiSeq12064_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12064
Unique NameHiSeq12064_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length299
Homology
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|913296956|ref|XP_013186530.1| (PREDICTED: traB domain-containing protein-like [Amyelois transitella])

HSP 1 Score: 484.567 bits (1246), Expect = 1.858e-170
Identity = 242/306 (79.08%), Postives = 266/306 (86.93%), Query Frame = 0
Query:    1 MRYQVCCFVRQFSKSLETVALCKQ----HQKLNTLCSTL--SRRNYSD--IPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVKGQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
            M  + C  +R ++  +++V L K+     +K  T  S L  S+R  SD  + LP +ATL+QND Q TVVLLGTVHFSKQSVEDVS IV+ LNPNAILVELCRQRVSLLELDDKKFLEDA+ FDARKMK+AVKGQN VSGMLHAMLLKTYADIAKELGVAPGGEFRRAY EMK+IPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTT+NPKPLD+  LE+YKD+DFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYS+QECVRTV   PRVLAVVGMGHVDGI+KYYG+MKQEDIVPLLF
Sbjct:    1 MINRTCNIIRYYNTVIDSVVLAKRITRTPRKRGTFNSLLGSSQRYLSDGGLSLPPAATLIQNDSQGTVVLLGTVHFSKQSVEDVSMIVKTLNPNAILVELCRQRVSLLELDDKKFLEDAQKFDARKMKDAVKGQNLVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYQEMKRIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTSNPKPLDRNSLEKYKDRDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSLQECVRTV-NNPRVLAVVGMGHVDGIVKYYGRMKQEDIVPLLF 305          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|357609061|gb|EHJ66278.1| (hypothetical protein KGM_13367 [Danaus plexippus])

HSP 1 Score: 467.233 bits (1201), Expect = 1.739e-161
Identity = 224/267 (83.90%), Postives = 247/267 (92.51%), Query Frame = 0
Query:   35 LSRRNYSD---IPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVKGQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
            ++ RN SD   +PLP SAT LQND  A VVLLGTVHFSK+SVEDVS+IV+VL PNAIL+ELCRQRVSLLELDD+KFLEDAKN +A+K+K+AVKGQ+F+SGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPI+ITIARAFQSL+V ELGQVLYHLTT+NPKPLDK QLERYKDKD+V AQFEEITR VPAFKK+FHVFVDERDKCLA+S+QECVR+V E PRVL VVGMGHVDGIMKYYG+MKQEDIVPLL 
Sbjct:  215 IAARNTSDAASLPLPPSATFLQNDDNAKVVLLGTVHFSKKSVEDVSEIVKVLKPNAILIELCRQRVSLLELDDRKFLEDAKNLNAQKIKDAVKGQSFMSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIRITIARAFQSLTVLELGQVLYHLTTSNPKPLDKDQLERYKDKDYVHAQFEEITRQVPAFKKVFHVFVDERDKCLAFSLQECVRSV-EKPRVLGVVGMGHVDGIMKYYGQMKQEDIVPLLL 480          

HSP 2 Score: 75.0998 bits (183), Expect = 1.310e-11
Identity = 35/64 (54.69%), Postives = 45/64 (70.31%), Query Frame = 0
Query:  142 ADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTAN 205
            A I +ELG+APGGEFRRA  E KKIP C + LGDR I IT+ RA  SL+  +  + ++HL T+N
Sbjct:    3 AHITRELGMAPGGEFRRAMAEAKKIPNCVIQLGDRAIDITLHRAISSLTWGQTIRFIWHLLTSN 66          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|768409066|ref|XP_011550851.1| (PREDICTED: traB domain-containing protein-like isoform X2 [Plutella xylostella])

HSP 1 Score: 445.662 bits (1145), Expect = 1.402e-155
Identity = 212/264 (80.30%), Postives = 240/264 (90.91%), Query Frame = 0
Query:   35 LSRRNYSDIPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVKGQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
             +RR+ + + LP SA+ LQND++ATVVLLGTVHFSKQSVEDVS IV+VLNPNAILVELCRQRVSLLELD++KFLEDAK FD +K ++AVKGQ+FVSGMLHAMLLKTYADI+KELGVAPGGEFRRAY EMKKIPGCKLFLGDRPIQ TIARAFQSLSVYELGQVL+HL+  +PKPL K+ LERYKDKDFVQAQF+EIT +VPAFKKIFHVFVDERD+CLAYS+QECV++V E PRVL VVGMGHVDGI +YYGKM+  +I PLLF
Sbjct:   34 FARRSATQLSLPPSASFLQNDEKATVVLLGTVHFSKQSVEDVSDIVKVLNPNAILVELCRQRVSLLELDEQKFLEDAKKFDLQKAQKAVKGQSFVSGMLHAMLLKTYADISKELGVAPGGEFRRAYQEMKKIPGCKLFLGDRPIQTTIARAFQSLSVYELGQVLFHLSKTSPKPLKKESLERYKDKDFVQAQFDEITNEVPAFKKIFHVFVDERDRCLAYSLQECVKSV-ESPRVLGVVGMGHVDGITRYYGKMEVAEIAPLLF 296          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|768409064|ref|XP_011550843.1| (PREDICTED: traB domain-containing protein-like isoform X1 [Plutella xylostella])

HSP 1 Score: 442.195 bits (1136), Expect = 7.489e-154
Identity = 211/264 (79.92%), Postives = 239/264 (90.53%), Query Frame = 0
Query:   35 LSRRNYSDIPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVKGQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
             +RR+ + + LP SA+ LQND++ATVVLLGTVHFSKQSVEDVS IV+VLNPNAILVELCRQRVSLLELD++KFLEDAK FD +K ++AVKGQ+FVSGMLHAMLLKTYADI+KELGVAPGGEFRRAY EMKKIPGCKLFLGDRPIQ TIARAFQSLSVYELGQVL+HL+  +PKPL K+ LERYKDKDFVQAQF+EIT +VPAFKKIFHVFVDERD+CLAYS+QECV++V E PRVL VVGMGHVDGI +YYGKM+  +I PLL 
Sbjct:   34 FARRSATQLSLPPSASFLQNDEKATVVLLGTVHFSKQSVEDVSDIVKVLNPNAILVELCRQRVSLLELDEQKFLEDAKKFDLQKAQKAVKGQSFVSGMLHAMLLKTYADISKELGVAPGGEFRRAYQEMKKIPGCKLFLGDRPIQTTIARAFQSLSVYELGQVLFHLSKTSPKPLKKESLERYKDKDFVQAQFDEITNEVPAFKKIFHVFVDERDRCLAYSLQECVKSV-ESPRVLGVVGMGHVDGITRYYGKMEVAEIAPLLL 296          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|909550821|ref|XP_013137070.1| (PREDICTED: traB domain-containing protein-like isoform X3 [Papilio polytes] >gi|909550823|ref|XP_013137079.1| PREDICTED: traB domain-containing protein-like isoform X3 [Papilio polytes])

HSP 1 Score: 431.024 bits (1107), Expect = 6.342e-150
Identity = 213/299 (71.24%), Postives = 249/299 (83.28%), Query Frame = 0
Query:    1 MRYQVCCFVRQFSKSLETVALCKQHQKLNTLCSTLSRRNYSDIPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVK-GQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
            MR      V    +++  + L KQ  K   L S     ++S +PLPS+AT+LQND  A VVLLGTVHFSK+SVE+V+QIV  L PNAILVELCRQRVSLLELDDKKFLEDAK FD++K  + +K  +  VSGMLHAMLLKTYAD+AKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITI+RAFQSLS+ E+GQVLYHL+  N KPLDK Q+E+YK K+FVQ+QF+EITR+VPAF+KIFHVFVDERD+CLAYS+QECVR+V + PRVLAVVGMGHV+GI +YYGKM+QEDIVPLL 
Sbjct:    1 MRIFCSKIVTLLKQNVTVITLRKQLNKSFILASRDCSSDFS-LPLPSTATVLQNDAAAKVVLLGTVHFSKKSVEEVTQIVHALKPNAILVELCRQRVSLLELDDKKFLEDAKKFDSKKFSQTMKEHKGVVSGMLHAMLLKTYADLAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITISRAFQSLSMIEIGQVLYHLSKTNQKPLDKLQIEKYKSKEFVQSQFDEITREVPAFRKIFHVFVDERDRCLAYSLQECVRSV-QNPRVLAVVGMGHVNGISRYYGKMRQEDIVPLLL 297          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|909550819|ref|XP_013137062.1| (PREDICTED: traB domain-containing protein-like isoform X2 [Papilio polytes])

HSP 1 Score: 429.869 bits (1104), Expect = 2.802e-149
Identity = 213/299 (71.24%), Postives = 249/299 (83.28%), Query Frame = 0
Query:    1 MRYQVCCFVRQFSKSLETVALCKQHQKLNTLCSTLSRRNYSDIPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVK-GQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
            MR      V    +++  + L KQ  K   L S     ++S +PLPS+AT+LQND  A VVLLGTVHFSK+SVE+V+QIV  L PNAILVELCRQRVSLLELDDKKFLEDAK FD++K  + +K  +  VSGMLHAMLLKTYAD+AKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITI+RAFQSLS+ E+GQVLYHL+  N KPLDK Q+E+YK K+FVQ+QF+EITR+VPAF+KIFHVFVDERD+CLAYS+QECVR+V + PRVLAVVGMGHV+GI +YYGKM+QEDIVPLL 
Sbjct:    1 MRIFCSKIVTLLKQNVTVITLRKQLNKSFILASRDCSSDFS-LPLPSTATVLQNDAAAKVVLLGTVHFSKKSVEEVTQIVHALKPNAILVELCRQRVSLLELDDKKFLEDAKKFDSKKFSQTMKEHKGVVSGMLHAMLLKTYADLAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITISRAFQSLSMIEIGQVLYHLSKTNQKPLDKLQIEKYKSKEFVQSQFDEITREVPAFRKIFHVFVDERDRCLAYSLQECVRSV-QNPRVLAVVGMGHVNGISRYYGKMRQEDIVPLLL 297          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|909550817|ref|XP_013137054.1| (PREDICTED: traB domain-containing protein-like isoform X1 [Papilio polytes])

HSP 1 Score: 430.254 bits (1105), Expect = 3.775e-149
Identity = 213/299 (71.24%), Postives = 249/299 (83.28%), Query Frame = 0
Query:    1 MRYQVCCFVRQFSKSLETVALCKQHQKLNTLCSTLSRRNYSDIPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVK-GQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
            MR      V    +++  + L KQ  K   L S     ++S +PLPS+AT+LQND  A VVLLGTVHFSK+SVE+V+QIV  L PNAILVELCRQRVSLLELDDKKFLEDAK FD++K  + +K  +  VSGMLHAMLLKTYAD+AKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITI+RAFQSLS+ E+GQVLYHL+  N KPLDK Q+E+YK K+FVQ+QF+EITR+VPAF+KIFHVFVDERD+CLAYS+QECVR+V + PRVLAVVGMGHV+GI +YYGKM+QEDIVPLL 
Sbjct:    1 MRIFCSKIVTLLKQNVTVITLRKQLNKSFILASRDCSSDFS-LPLPSTATVLQNDAAAKVVLLGTVHFSKKSVEEVTQIVHALKPNAILVELCRQRVSLLELDDKKFLEDAKKFDSKKFSQTMKEHKGVVSGMLHAMLLKTYADLAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITISRAFQSLSMIEIGQVLYHLSKTNQKPLDKLQIEKYKSKEFVQSQFDEITREVPAFRKIFHVFVDERDRCLAYSLQECVRSV-QNPRVLAVVGMGHVNGISRYYGKMRQEDIVPLLL 297          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|943967499|ref|XP_014365712.1| (PREDICTED: traB domain-containing protein-like isoform X2 [Papilio machaon] >gi|943967502|ref|XP_014365713.1| PREDICTED: traB domain-containing protein-like isoform X2 [Papilio machaon] >gi|943967505|ref|XP_014365714.1| PREDICTED: traB domain-containing protein-like isoform X2 [Papilio machaon] >gi|943967507|ref|XP_014365715.1| PREDICTED: traB domain-containing protein-like isoform X2 [Papilio machaon])

HSP 1 Score: 421.779 bits (1083), Expect = 2.694e-146
Identity = 208/284 (73.24%), Postives = 241/284 (84.86%), Query Frame = 0
Query:   18 TVALCKQHQKLNTLCSTLSRRNYSD--IPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVK-GQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
             VA+    + LN   +  SR    D  + LPS+AT+LQND  A VV+LGTVHFSK+SVE+VSQIV  L PNAILVELCRQRVSLLELDDKKFLEDAK FD++K  + +K  +  VSGMLHAMLLKTYAD+AKELGVAPGGEFRRAY EMKKIPGCKLFLGDRPIQITI+RAFQSL++ E+GQVLYHL+  N KPLDK Q+E+YK K+FVQ+QF+EITR+VPAFKKIFHVFVDERD+CLAYS+QECVRTV + PRVLAVVG+GHV+GI +YYGKM+QEDIVPLL 
Sbjct:   15 NVAVLSAREPLNKSVTLPSRVCSYDFGLTLPSTATVLQNDAAAKVVVLGTVHFSKKSVEEVSQIVHTLKPNAILVELCRQRVSLLELDDKKFLEDAKKFDSKKFSQTMKEHKGVVSGMLHAMLLKTYADLAKELGVAPGGEFRRAYQEMKKIPGCKLFLGDRPIQITISRAFQSLNMIEIGQVLYHLSKTNQKPLDKLQIEKYKSKEFVQSQFDEITREVPAFKKIFHVFVDERDRCLAYSLQECVRTV-QNPRVLAVVGIGHVNGISRYYGKMRQEDIVPLLL 297          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|943967497|ref|XP_014365711.1| (PREDICTED: traB domain-containing protein-like isoform X1 [Papilio machaon])

HSP 1 Score: 422.165 bits (1084), Expect = 4.151e-146
Identity = 208/284 (73.24%), Postives = 241/284 (84.86%), Query Frame = 0
Query:   18 TVALCKQHQKLNTLCSTLSRRNYSD--IPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVK-GQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
             VA+    + LN   +  SR    D  + LPS+AT+LQND  A VV+LGTVHFSK+SVE+VSQIV  L PNAILVELCRQRVSLLELDDKKFLEDAK FD++K  + +K  +  VSGMLHAMLLKTYAD+AKELGVAPGGEFRRAY EMKKIPGCKLFLGDRPIQITI+RAFQSL++ E+GQVLYHL+  N KPLDK Q+E+YK K+FVQ+QF+EITR+VPAFKKIFHVFVDERD+CLAYS+QECVRTV + PRVLAVVG+GHV+GI +YYGKM+QEDIVPLL 
Sbjct:   15 NVAVLSAREPLNKSVTLPSRVCSYDFGLTLPSTATVLQNDAAAKVVVLGTVHFSKKSVEEVSQIVHTLKPNAILVELCRQRVSLLELDDKKFLEDAKKFDSKKFSQTMKEHKGVVSGMLHAMLLKTYADLAKELGVAPGGEFRRAYQEMKKIPGCKLFLGDRPIQITISRAFQSLNMIEIGQVLYHLSKTNQKPLDKLQIEKYKSKEFVQSQFDEITREVPAFKKIFHVFVDERDRCLAYSLQECVRTV-QNPRVLAVVGIGHVNGISRYYGKMRQEDIVPLLL 297          
BLAST of HiSeq12064 vs. genbank:protein
Match: gi|910348606|ref|XP_013178288.1| (PREDICTED: traB domain-containing protein-like isoform X3 [Papilio xuthus] >gi|910348608|ref|XP_013178289.1| PREDICTED: traB domain-containing protein-like isoform X3 [Papilio xuthus])

HSP 1 Score: 419.083 bits (1076), Expect = 2.626e-145
Identity = 201/259 (77.61%), Postives = 232/259 (89.58%), Query Frame = 0
Query:   41 SDIPLPSSATLLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLLELDDKKFLEDAKNFDARKMKEAVK-GQNFVSGMLHAMLLKTYADIAKELGVAPGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYHLTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDKCLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLF 298
            S + LP++AT+LQND  A VV+LGTVHFSK+SVE+VSQIV  L PNAILVELCRQRVSLLELDDKKFLEDAK FD++K  + +K  +  VSGMLHAMLLKTYAD+AKELGVAPGGEFRRAY EMKKIPGCKLFLGDRPIQITI+RAFQSL++ E+GQVLYHL+  N KPLDK Q+E+YK K+FVQ+QF+EITR+VPAFKKIFHVFVDERD+CLAYS+QECVRTV + PRVLAVVG+GHV+GI +YYGKM+QEDIVPLL 
Sbjct:   40 SGLTLPNTATVLQNDAAAKVVVLGTVHFSKKSVEEVSQIVHSLKPNAILVELCRQRVSLLELDDKKFLEDAKKFDSKKFSQTMKEHKGVVSGMLHAMLLKTYADLAKELGVAPGGEFRRAYQEMKKIPGCKLFLGDRPIQITISRAFQSLNMIEIGQVLYHLSKTNQKPLDKFQIEKYKSKEFVQSQFDEITREVPAFKKIFHVFVDERDRCLAYSLQECVRTV-QNPRVLAVVGIGHVNGISRYYGKMRQEDIVPLLL 297          
The following BLAST results are available for this feature:
BLAST of HiSeq12064 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913296956|ref|XP_013186530.1|1.858e-17079.08PREDICTED: traB domain-containing protein-like [Am... [more]
gi|357609061|gb|EHJ66278.1|1.739e-16183.90hypothetical protein KGM_13367 [Danaus plexippus][more]
gi|768409066|ref|XP_011550851.1|1.402e-15580.30PREDICTED: traB domain-containing protein-like iso... [more]
gi|768409064|ref|XP_011550843.1|7.489e-15479.92PREDICTED: traB domain-containing protein-like iso... [more]
gi|909550821|ref|XP_013137070.1|6.342e-15071.24PREDICTED: traB domain-containing protein-like iso... [more]
gi|909550819|ref|XP_013137062.1|2.802e-14971.24PREDICTED: traB domain-containing protein-like iso... [more]
gi|909550817|ref|XP_013137054.1|3.775e-14971.24PREDICTED: traB domain-containing protein-like iso... [more]
gi|943967499|ref|XP_014365712.1|2.694e-14673.24PREDICTED: traB domain-containing protein-like iso... [more]
gi|943967497|ref|XP_014365711.1|4.151e-14673.24PREDICTED: traB domain-containing protein-like iso... [more]
gi|910348606|ref|XP_013178288.1|2.626e-14577.61PREDICTED: traB domain-containing protein-like iso... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002816Pheromone shutdown, TraBPFAMPF01963TraBcoord: 55..291
e-value: 5.7E-36
score: 124.1
NoneNo IPR availablePANTHERPTHR21530PHEROMONE SHUTDOWN PROTEINcoord: 45..297
NoneNo IPR availablePANTHERPTHR21530:SF0TRAB DOMAIN-CONTAINING PROTEINcoord: 45..297

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12064HiSeq12064Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12064_p ID=HiSeq12064_p|Name=HiSeq12064|organism=Ostrinia scapulalis|type=polypeptide|length=299bp
MRYQVCCFVRQFSKSLETVALCKQHQKLNTLCSTLSRRNYSDIPLPSSAT
LLQNDKQATVVLLGTVHFSKQSVEDVSQIVRVLNPNAILVELCRQRVSLL
ELDDKKFLEDAKNFDARKMKEAVKGQNFVSGMLHAMLLKTYADIAKELGV
APGGEFRRAYHEMKKIPGCKLFLGDRPIQITIARAFQSLSVYELGQVLYH
LTTANPKPLDKQQLERYKDKDFVQAQFEEITRDVPAFKKIFHVFVDERDK
CLAYSIQECVRTVPEGPRVLAVVGMGHVDGIMKYYGKMKQEDIVPLLFG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR002816Pheromone_shutdown_TraB