HiSeq12072_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12072
Unique NameHiSeq12072_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length339
Homology
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|913325371|ref|XP_013194045.1| (PREDICTED: protein wings apart-like [Amyelois transitella])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 286/339 (84.37%), Postives = 307/339 (90.56%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAPPVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKED-PSSDAQPPNKRYLVRNRDKVINYAEDGSNSPIPDFSRYE--PLQ---PKLNRVTQSQSPKIPSPMASPVLASPTP--IKTGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDHKKSPSMETICSPKHEGLKITIKCAGLNQES 331
            MSRWGRGRAGSVAVPLDSALFRENSNCP+AARSAGTVGKWGITSFTSIRSAPYAFANNVVKKP+QDQNSPLTVPAVETEQ PPKPKKFFKSRNAE YPPVPQITYAPPVPAAPLSPEHPSNS+EKK  KRSRVYNRDSSSPELPRR+ EKS+SKK ++ATKASRKE+ P+ + QPPNKRYLVRNRDKVINYAEDGSNSPIPDFS +E  P++   PK+       SP++ SP ASPV++SPTP   KT + SPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEG TSP SDRHSSLDTHSD GSDHKKSPS+ETICSPKHEGLKITIKCAGLNQE+
Sbjct:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPSAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPIQDQNSPLTVPAVETEQAPPKPKKFFKSRNAEPYPPVPQITYAPPVPAAPLSPEHPSNSREKKPTKRSRVYNRDSSSPELPRRNSEKSRSKK-TLATKASRKEEVPAPNTQPPNKRYLVRNRDKVINYAEDGSNSPIPDFSHFELPPVKIPSPKI------ASPQVASPKASPVISSPTPASTKTSIPSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGFTSPSSDRHSSLDTHSDIGSDHKKSPSVETICSPKHEGLKITIKCAGLNQET 332          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|1073536009|gb|JAT85116.1| (hypothetical protein g.13796, partial [Pectinophora gossypiella])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 282/332 (84.94%), Postives = 296/332 (89.16%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAPPVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKED---PSSDAQPPNKRYLVRNRDKVINYAEDGSNSPIPDFSRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIKTGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDHKKSPSMETICSPKHEGLKITIKCAGLNQ 329
            MSRWGRGR+GSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAF NNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAE YPPVP ITYAPPVPAAPLSPEH SNS+EKKTNKRSRVYNRDSSSPELPRRS +K+K+KK SVATKASRKED   P  + QPPNKRYLVRNRDKVINYAEDGSNSPIPDFS Y+   P         S KI SP  SP++ASPTP K  V SPSTSKD++EERKPPPIVLRISKGTSRIVSTDSNEG TSP SDRHSS+DTHSD GSDHKKSPS+ETICSPKHEGLKITIKC+GLNQ
Sbjct:    1 MSRWGRGRSGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFGNNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAELYPPVPTITYAPPVPAAPLSPEHSSNSREKKTNKRSRVYNRDSSSPELPRRS-DKTKAKKGSVATKASRKEDAGGPGENTQPPNKRYLVRNRDKVINYAEDGSNSPIPDFSSYDRPLP---------SAKIASPKTSPLVASPTPAKVDVASPSTSKDTSEERKPPPIVLRISKGTSRIVSTDSNEGFTSPSSDRHSSMDTHSDIGSDHKKSPSVETICSPKHEGLKITIKCSGLNQ 322          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|512924376|ref|XP_004930580.1| (PREDICTED: protein wings apart-like [Bombyx mori])

HSP 1 Score: 504.982 bits (1299), Expect = 1.124e-165
Identity = 266/330 (80.61%), Postives = 293/330 (88.79%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAPPVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKED-PSSDAQPPNKRYLVRNRDKVINYAEDGSNSPIPDF-SRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIKTGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDHKKSPSMETICSPKHEGLKITIKCAGLN 328
            MSRWGRGR GSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYA+++NV+KKPVQDQNSPLTVPAVE EQPPPKPKKFFKSRNAE YPPVPQITYAPPVPAAPLSPEHPS+SKEKK  +R+  + RDSSSPE+P RS EK+K+KK++VATKA++KED P+ +AQPPNKRYLVRNR+KVINYAEDGSNSPIP+F SRYEPL  K      + SPKIP+P+ASP L + T +K  V SPSTSKD+NEERKPPPIVLRISKGTSRIVSTDSNEG TSP SDRHSSLD HSD G DHKKSPS+ETICSPK E LKITIKC G+N
Sbjct:    1 MSRWGRGRGGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAYSSNVLKKPVQDQNSPLTVPAVEAEQPPPKPKKFFKSRNAELYPPVPQITYAPPVPAAPLSPEHPSHSKEKKPKRRT--HTRDSSSPEIPWRSSEKNKTKKSTVATKAAKKEDVPAENAQPPNKRYLVRNRNKVINYAEDGSNSPIPEFTSRYEPLHVK------ASSPKIPTPLASPSLENQTLVKAEVSSPSTSKDANEERKPPPIVLRISKGTSRIVSTDSNEGFTSPNSDRHSSLDMHSDVGFDHKKSPSVETICSPKQESLKITIKCPGIN 322          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|357621805|gb|EHJ73511.1| (wings apart-like protein [Danaus plexippus])

HSP 1 Score: 494.582 bits (1272), Expect = 9.731e-162
Identity = 264/334 (79.04%), Postives = 291/334 (87.13%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAPPVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKEDPSSD-AQPPNKRYLVRNRDKVINYAEDGSNSPIPDFSRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIKTGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSD--FGSDHKKSPSMETICSPKHEGLKITIKCAGLNQES 331
            MSRWGRGR+GSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYA+ +N+ KK +QDQNSPLTVPAVETEQPPPKPKKFFKSRNAE YPPVPQITYAPPV AAPLSPEH SN+KEK+TNKR R YNRDSSSPELPRR+ EK KS++  +ATKA++KED S+D +QPPNKRYLVRNRDKVINYAEDGSNSPIP+ +RYE L           S K  SP ASP++  P+PIKT V SPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSP SDRHSSLDTH D   GSD K+SP+ ++ICSPK EGLKITIKC+G+NQE+
Sbjct:    1 MSRWGRGRSGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAYQSNIHKKSIQDQNSPLTVPAVETEQPPPKPKKFFKSRNAELYPPVPQITYAPPVSAAPLSPEH-SNTKEKRTNKRGR-YNRDSSSPELPRRNSEKGKSRR-GLATKAAKKEDQSNDSSQPPNKRYLVRNRDKVINYAEDGSNSPIPELTRYESL-----------SHKALSPKASPLVKCPSPIKTEVASPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPSSDRHSSLDTHFDISIGSDAKRSPTADSICSPKQEGLKITIKCSGINQET 320          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|914566097|gb|KOB70873.1| (Wings apart-like protein, partial [Operophtera brumata])

HSP 1 Score: 479.174 bits (1232), Expect = 4.803e-158
Identity = 274/334 (82.04%), Postives = 295/334 (88.32%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAPPVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPR-RSFEKSKSKKNSVATKASRKEDPSS-DAQPPNKRYLVRNRDKVINYAEDGSNSPIPDFSRYE-PLQPKLNRVTQS---QSPKIPSPMASPVLASPTPIKTGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDH-KKSPSMETICSPKHEGLKITIKCAGL 327
            MSRWGRGR+GSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYA+ NNV+KKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEA+PPVPQITYAPPVP APLSPEHPSN KEKK +KRSR+YNRDSSSPE+P   S EKSK+KKN VATKA++KE+    + QPPNKRYLVRNRDKVINYAEDGSNSPIPD SRYE P  PK++    +    SPKIPSP ASPV++SP   K    SPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEG TSPGSDRHSSLDTHSD GS+  KKSP++E+ICSPKHEGLKITIKC GL
Sbjct:    1 MSRWGRGRSGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAYTNNVIKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAFPPVPQITYAPPVPPAPLSPEHPSNIKEKKNSKRSRIYNRDSSSPEIPWGGSTEKSKTKKN-VATKAAKKEEAVDPNLQPPNKRYLVRNRDKVINYAEDGSNSPIPDLSRYELPPPPKISTQIYTPKLPSPKIPSPKASPVISSPICTKMDAASPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGFTSPGSDRHSSLDTHSDIGSETIKKSPAVESICSPKHEGLKITIKCPGL 333          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|943953727|ref|XP_014359769.1| (PREDICTED: protein wings apart-like isoform X1 [Papilio machaon] >gi|943953729|ref|XP_014359770.1| PREDICTED: protein wings apart-like isoform X2 [Papilio machaon] >gi|943953731|ref|XP_014359771.1| PREDICTED: protein wings apart-like isoform X1 [Papilio machaon])

HSP 1 Score: 478.404 bits (1230), Expect = 3.325e-155
Identity = 264/335 (78.81%), Postives = 290/335 (86.57%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAP-PVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKEDPSSD-AQPPNKRYLVRNRDKVINYAEDGSNSPIPDFSRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIK--TGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDHKKSPSMETICSPKHEGLKITIKCAGLNQES 331
            MSRWGRGR GSVAVPLDSALFRENSNCP+AARSAGTVGKWG+TSFTSIRSAPYA+ N   KKPVQDQNSPLTVPAV+TEQPPPKPKKFFKSRNAE +PPVPQI YAP  VP  PLSPEHP + KEKK+ KR R YNRDSSSPELPRR+ EK+K+KKN+VATKAS+KE+P+SD +QPPNKRYLVRNR KVINYAEDGSNSPIPD +RYE L       ++SQSPK     ASP+++SP P K    VVSPSTSK+SNEERKPPPIVLRISKGTSRIVSTDSNEG TSPGSDRHSS+D HSD   DHKKSPSMETICSPKHEGLKITIKC+ L+QE+
Sbjct:    1 MSRWGRGRGGSVAVPLDSALFRENSNCPSAARSAGTVGKWGMTSFTSIRSAPYAYNN--AKKPVQDQNSPLTVPAVDTEQPPPKPKKFFKSRNAETFPPVPQIAYAPQQVP--PLSPEHPPSFKEKKSTKRCR-YNRDSSSPELPRRNSEKTKTKKNTVATKASKKEEPTSDNSQPPNKRYLVRNRSKVINYAEDGSNSPIPDMTRYESLP------SRSQSPK-----ASPLISSPVPAKPVADVVSPSTSKESNEERKPPPIVLRISKGTSRIVSTDSNEGFTSPGSDRHSSMDMHSDL--DHKKSPSMETICSPKHEGLKITIKCSSLSQEN 317          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|930673615|gb|KPJ14092.1| (Protein wings apart-like [Papilio machaon])

HSP 1 Score: 479.559 bits (1233), Expect = 1.775e-153
Identity = 264/335 (78.81%), Postives = 290/335 (86.57%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAP-PVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKEDPSSD-AQPPNKRYLVRNRDKVINYAEDGSNSPIPDFSRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIK--TGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDHKKSPSMETICSPKHEGLKITIKCAGLNQES 331
            MSRWGRGR GSVAVPLDSALFRENSNCP+AARSAGTVGKWG+TSFTSIRSAPYA+ N   KKPVQDQNSPLTVPAV+TEQPPPKPKKFFKSRNAE +PPVPQI YAP  VP  PLSPEHP + KEKK+ KR R YNRDSSSPELPRR+ EK+K+KKN+VATKAS+KE+P+SD +QPPNKRYLVRNR KVINYAEDGSNSPIPD +RYE L       ++SQSPK     ASP+++SP P K    VVSPSTSK+SNEERKPPPIVLRISKGTSRIVSTDSNEG TSPGSDRHSS+D HSD   DHKKSPSMETICSPKHEGLKITIKC+ L+QE+
Sbjct:    1 MSRWGRGRGGSVAVPLDSALFRENSNCPSAARSAGTVGKWGMTSFTSIRSAPYAYNN--AKKPVQDQNSPLTVPAVDTEQPPPKPKKFFKSRNAETFPPVPQIAYAPQQVP--PLSPEHPPSFKEKKSTKRCR-YNRDSSSPELPRRNSEKTKTKKNTVATKASKKEEPTSDNSQPPNKRYLVRNRSKVINYAEDGSNSPIPDMTRYESLP------SRSQSPK-----ASPLISSPVPAKPVADVVSPSTSKESNEERKPPPIVLRISKGTSRIVSTDSNEGFTSPGSDRHSSMDMHSDL--DHKKSPSMETICSPKHEGLKITIKCSSLSQEN 317          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|909568046|ref|XP_013139459.1| (PREDICTED: protein wings apart-like [Papilio polytes])

HSP 1 Score: 472.626 bits (1215), Expect = 2.725e-153
Identity = 265/336 (78.87%), Postives = 288/336 (85.71%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAP-PVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKEDPSSD-AQPPNKRYLVRNRDKVINYAEDGSNSPIPDF-SRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIK--TGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDHKKSPSMETICSPKHEGLKITIKCAGLNQES 331
            MSRWGRGR GSVAVPLDSALFRENSNCP+AARSAGTVGKWG+TSFTSIRSAPYA+  N  KKPVQDQNSPLTVPAV+TEQPPPKPKKFFKSRNAE +PPVPQI YAP  VP  PLSPEHP + KEKK+ K+ R YNRDSSSPELPRR+ EK+K KK +VATKAS+KE+P SD +QPPNKRYLVRNR KVINYAEDGSNSPIPD  +RYE L PK      +QSPK     ASP+++SP P K    VVSPSTSK+SNEERKPPPIVLRISKGTSRIVSTDSNEG TSPGSDRHSS+D HSDF  DHKKSPSMETICSPKHEGLKITIKC+ LNQE+
Sbjct:    1 MSRWGRGRGGSVAVPLDSALFRENSNCPSAARSAGTVGKWGMTSFTSIRSAPYAY--NTAKKPVQDQNSPLTVPAVDTEQPPPKPKKFFKSRNAETFPPVPQIAYAPQQVP--PLSPEHPPSFKEKKSTKKCR-YNRDSSSPELPRRNSEKAKPKKTTVATKASKKEEPISDNSQPPNKRYLVRNRSKVINYAEDGSNSPIPDMTTRYESLPPK------AQSPK-----ASPLISSPVPAKPIPEVVSPSTSKESNEERKPPPIVLRISKGTSRIVSTDSNEGFTSPGSDRHSSMDMHSDF--DHKKSPSMETICSPKHEGLKITIKCSSLNQEN 318          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|930657652|gb|KPI99945.1| (Protein wings apart-like [Papilio xuthus])

HSP 1 Score: 454.136 bits (1167), Expect = 5.549e-146
Identity = 264/336 (78.57%), Postives = 289/336 (86.01%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAP-PVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKEDPSSD-AQPPNKRYLVRNRDKVINYAEDGSNSPIPDF-SRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIK--TGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDHKKSPSMETICSPKHEGLKITIKCAGLNQES 331
            MSRWGRGR GSVAVPLDSALFRENSNCP+AARSAGTVGKWG+TSFTSIRSAPYA+ N   KKPVQDQNSPLTVPAV+TEQPPPKPKKFFKSRNAE +PPVPQI YAP  VP  PLSPEHP + KEKK+ KR R YNRDSSSPELPRR+ EK+K+KK +VATKAS+KE+P+SD +QPPNKRYLVRNR KVINYAEDGSNSPIPD  +RYE L P+      +QSPK     ASP+++SP P K    VVSPSTSK+SNEERKPPPIVLRISKGTSRIVSTDSNEG TSPGSDRHSS+D HSD   DHKKSPSMETICSPKHEGLKITIKC+ LNQE+
Sbjct:    1 MSRWGRGRGGSVAVPLDSALFRENSNCPSAARSAGTVGKWGMTSFTSIRSAPYAYNN--AKKPVQDQNSPLTVPAVDTEQPPPKPKKFFKSRNAETFPPVPQIAYAPQQVP--PLSPEHPPSFKEKKSTKRCR-YNRDSSSPELPRRNSEKTKTKKTTVATKASKKEEPTSDNSQPPNKRYLVRNRSKVINYAEDGSNSPIPDMTTRYESLPPR------AQSPK-----ASPLISSPVPAKPVADVVSPSTSKESNEERKPPPIVLRISKGTSRIVSTDSNEGFTSPGSDRHSSMDMHSDL--DHKKSPSMETICSPKHEGLKITIKCSSLNQEN 318          
BLAST of HiSeq12072 vs. genbank:protein
Match: gi|910340579|ref|XP_013173967.1| (PREDICTED: protein wings apart-like [Papilio xuthus] >gi|910340582|ref|XP_013173968.1| PREDICTED: protein wings apart-like [Papilio xuthus])

HSP 1 Score: 453.366 bits (1165), Expect = 1.399e-145
Identity = 263/336 (78.27%), Postives = 288/336 (85.71%), Query Frame = 0
Query:    1 MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRSAPYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPVPQITYAP-PVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEKSKSKKNSVATKASRKEDPSSD-AQPPNKRYLVRNRDKVINYAEDGSNSPIPDF-SRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIK--TGVVSPSTSKDSNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSDHKKSPSMETICSPKHEGLKITIKCAGLNQES 331
            MSRWGRGR GSVAVPLDSALFRENSNCP+AARSAGTVGKWG+TSFTSIRSAPYA+ N   KKPVQDQNSPLTVPAV+TEQPPPKPKKFFKSRNAE +PPVPQI YAP  VP  PLSPEHP + KEKK+ KR R YNRDSSSPELPRR+ EK+K+KK +VATKAS+KE+P+SD +QPPNKRYLVRNR KVINYAEDGSNSPIPD  +RYE L P+      +QSPK     ASP+++SP P K    VVSPSTSK+ NEERKPPPIVLRISKGTSRIVSTDSNEG TSPGSDRHSS+D HSD   DHKKSPSMETICSPKHEGLKITIKC+ LNQE+
Sbjct:    1 MSRWGRGRGGSVAVPLDSALFRENSNCPSAARSAGTVGKWGMTSFTSIRSAPYAYNN--AKKPVQDQNSPLTVPAVDTEQPPPKPKKFFKSRNAETFPPVPQIAYAPQQVP--PLSPEHPPSFKEKKSTKRCR-YNRDSSSPELPRRNSEKTKTKKTTVATKASKKEEPTSDNSQPPNKRYLVRNRSKVINYAEDGSNSPIPDMTTRYESLPPR------AQSPK-----ASPLISSPVPAKPVADVVSPSTSKELNEERKPPPIVLRISKGTSRIVSTDSNEGFTSPGSDRHSSMDMHSDL--DHKKSPSMETICSPKHEGLKITIKCSSLNQEN 318          
The following BLAST results are available for this feature:
BLAST of HiSeq12072 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913325371|ref|XP_013194045.1|0.000e+084.37PREDICTED: protein wings apart-like [Amyelois tran... [more]
gi|1073536009|gb|JAT85116.1|0.000e+084.94hypothetical protein g.13796, partial [Pectinophor... [more]
gi|512924376|ref|XP_004930580.1|1.124e-16580.61PREDICTED: protein wings apart-like [Bombyx mori][more]
gi|357621805|gb|EHJ73511.1|9.731e-16279.04wings apart-like protein [Danaus plexippus][more]
gi|914566097|gb|KOB70873.1|4.803e-15882.04Wings apart-like protein, partial [Operophtera bru... [more]
gi|943953727|ref|XP_014359769.1|3.325e-15578.81PREDICTED: protein wings apart-like isoform X1 [Pa... [more]
gi|930673615|gb|KPJ14092.1|1.775e-15378.81Protein wings apart-like [Papilio machaon][more]
gi|909568046|ref|XP_013139459.1|2.725e-15378.87PREDICTED: protein wings apart-like [Papilio polyt... [more]
gi|930657652|gb|KPI99945.1|5.549e-14678.57Protein wings apart-like [Papilio xuthus][more]
gi|910340579|ref|XP_013173967.1|1.399e-14578.27PREDICTED: protein wings apart-like [Papilio xuthu... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12072HiSeq12072Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12072_p ID=HiSeq12072_p|Name=HiSeq12072|organism=Ostrinia scapulalis|type=polypeptide|length=339bp
MSRWGRGRAGSVAVPLDSALFRENSNCPTAARSAGTVGKWGITSFTSIRS
APYAFANNVVKKPVQDQNSPLTVPAVETEQPPPKPKKFFKSRNAEAYPPV
PQITYAPPVPAAPLSPEHPSNSKEKKTNKRSRVYNRDSSSPELPRRSFEK
SKSKKNSVATKASRKEDPSSDAQPPNKRYLVRNRDKVINYAEDGSNSPIP
DFSRYEPLQPKLNRVTQSQSPKIPSPMASPVLASPTPIKTGVVSPSTSKD
SNEERKPPPIVLRISKGTSRIVSTDSNEGLTSPGSDRHSSLDTHSDFGSD
HKKSPSMETICSPKHEGLKITIKCAGLNQESKKEKKKEK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane