HiSeq12111_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12111
Unique NameHiSeq12111_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length51
Homology
The following BLAST results are available for this feature:
BLAST of HiSeq12111 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12111HiSeq12111Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12111_p ID=HiSeq12111_p|Name=HiSeq12111|organism=Ostrinia scapulalis|type=polypeptide|length=51bp
MGNMLTGVSMVMYGVMYLERWLQGLPNPPKPEDPIPTEHSRHMPPPPPMQ
G
back to top