HiSeq12121_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12121
Unique NameHiSeq12121_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length387
Homology
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|357625267|gb|EHJ75768.1| (hypothetical protein KGM_20044 [Danaus plexippus])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 279/388 (71.91%), Postives = 325/388 (83.76%), Query Frame = 0
Query:    5 VLLVLSYVLTVYGNLEGPFLFFGPESLEKYKRPALKNLDQDDLMRIYGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQGPSLEYSEPGSWARARREAD----ASAEPPAEDEKPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGD-SRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            V L+ S     +GNLEGPFLFFGP SL+KY+RPAL++LDQDDLMRIYGE+ AIVVFNNQDSVPL+SG FPRLRKMLEG TTLVLPQDFLDVHPDYISNETQ+LTLQGPWSERDAQMTETFARLQDIYG+GRVLG+LGNSVSQ      +E   W R RR+A      SA      EKP + LQ++ALYNATGPPG++ALLYS+GWPE+RW +G+VTVLD+PVGEPT+KPTRLYTILVVRFADGD +RDKITLEFSFKQS  WW AVGVE++ G+E TGLN+ A  P   P+AVLG ++ CSLPL Y +++A L FPD+ +QPFM++TEKF+DAF+CIGFTTVPIWSGL V+ +++  L VSI MI+DIKTMDRFENNRSKQLTITV E
Sbjct:    4 VFLIFSLFCYCHGNLEGPFLFFGPHSLQKYRRPALQSLDQDDLMRIYGEQTAIVVFNNQDSVPLSSGIFPRLRKMLEGQTTLVLPQDFLDVHPDYISNETQVLTLQGPWSERDAQMTETFARLQDIYGAGRVLGVLGNSVSQSQPYYETE---WTRVRRQAKDVTTTSATTEDVQEKPARNLQKYALYNATGPPGKAALLYSSGWPELRWPDGTVTVLDSPVGEPTIKPTRLYTILVVRFADGDNTRDKITLEFSFKQSGSWWSAVGVEIRRGLETTGLNMPALDP---PAAVLGRAFHCSLPLIYEADDARLTFPDIRIQPFMESTEKFADAFDCIGFTTVPIWSGLMVTGLMLVVLFVSICMIMDIKTMDRFENNRSKQLTITVYE 385          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|768416777|ref|XP_011548992.1| (PREDICTED: uncharacterized protein LOC105381050 [Plutella xylostella])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 291/386 (75.39%), Postives = 330/386 (85.49%), Query Frame = 0
Query:    4 PVLLVLSYVLTVYGNLEGPFLFFGPESLEKYKRPALKNLDQDDLMRIYGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQGPSLEYSEPGSWARARREADAS-AEPPAEDEKPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGD-SRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            P   + +Y+ T+  NLEGPFLFFGP+SL K+KRPALK L+QDDLM+IYGE+AAIVVFNNQDS PL+SG+FPRLRK+LEG TTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLG+LGNSVSQ  S   +E   W RARR AD   +   AE E       ++ALYNATGPPG+ ALL+S+GWPE+RW +GS TVLDTPVGEPTVKPTRLYTILVVRFADGD +RDKITLEFSFKQS GWW AVGVEVK G+E TGLNL+AP+PP APSAVLG +Y CSLPL Y+SEEA+L  PDV+MQPFMD+TEKF+DAF+CIGFT+VPIWSGL V+ +LI  L +SI MILDIKTMDRFEN+R KQL+ITVSE
Sbjct:    6 PCAFLFAYLHTICANLEGPFLFFGPKSLSKFKRPALKYLEQDDLMKIYGEQAAIVVFNNQDSRPLSSGSFPRLRKLLEGQTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGLLGNSVSQPVSYSGAE---W-RARRSADDDVSTTTAEPEYSAGGKNKYALYNATGPPGKGALLFSSGWPELRWPDGSATVLDTPVGEPTVKPTRLYTILVVRFADGDNTRDKITLEFSFKQSQGWWTAVGVEVKRGLESTGLNLQAPAPPQAPSAVLGRAYHCSLPLVYASEEASLTLPDVMMQPFMDSTEKFADAFDCIGFTSVPIWSGLMVTFLLILMLSISICMILDIKTMDRFENSRGKQLSITVSE 387          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|827537403|ref|XP_012547044.1| (PREDICTED: uncharacterized protein LOC101739289 [Bombyx mori])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 286/373 (76.68%), Postives = 321/373 (86.06%), Query Frame = 0
Query:   18 NLEGPFLFFGPESLEKYKRPALKNLDQDDLMRIYGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQGPSLEYSEPGSWARARREADASAEPPA--EDEKPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGDSRDKITLEFSFKQSAGWWQAVGVEVKFG-VEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            NLEGPFLFFGP+SLEKYKRPALK LDQD+L +IYGE+AAIVVFNNQDSVPL+SG FPRLRKMLEG T LVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYG+GRVLGILGNSVSQ  S +Y E G W+R RR+       P+  E+EK  K + ++ALYNATGPPG+ ALLYS+GWPE+R ANG   VL   VGE TVKPTRLYT+LVV+FADGDSRDKITLEFSFKQSAGWW AVGVEV FG +E +GLNLKAP+PPDAPSAVLG SY CS PL Y+S+EA L  PDV MQ FMD+TE+F+DAF+CIGFTTVPIWSGL VS +++ GL VS+ MI+DIKTMDRFE+NRSKQLTITV+E
Sbjct: 1106 NLEGPFLFFGPKSLEKYKRPALKYLDQDELTKIYGEQAAIVVFNNQDSVPLSSGYFPRLRKMLEGQTVLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGAGRVLGILGNSVSQSQSPDYVE-GEWSRVRRQTGNETTTPSGQEEEKMTKAVPKYALYNATGPPGKGALLYSSGWPELRLANGKRVVLSNQVGECTVKPTRLYTMLVVKFADGDSRDKITLEFSFKQSAGWWTAVGVEVIFGSLETSGLNLKAPAPPDAPSAVLGRSYHCSQPLVYTSDEAILRLPDVQMQIFMDSTERFADAFDCIGFTTVPIWSGLMVSFIMLLGLAVSVCMIMDIKTMDRFESNRSKQLTITVNE 1477          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|930661020|gb|KPJ02962.1| (V-type proton ATPase subunit S1 [Papilio xuthus])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 278/386 (72.02%), Postives = 320/386 (82.90%), Query Frame = 0
Query:   17 GNLEGPFLFFGPESLEKYKRPALKNLDQDDLMRIYGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQ------GPSLEYSEPGSWARARREADASAEPP--------AEDEKPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGD-SRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            GNLEGPFLFFGP SLEKYKR AL+ L+QDDLMRIYGE+AAIVVFNNQD VPL+SG FPRLRKMLE  + LVLPQDFLDVHPDY+SNETQ+LTLQG WSERDAQMTETFARLQDIYG GRVLG+LGNSVSQ      GP  E +EPG W  A R      + P         +D+KP KVL ++ALYNATGPPG++ALLYS+GWPE++WA+GSVTVLDTP+GEPT+KPTRLYTILVVRFADGD +RDKITLEFSFKQSAGWW A GVEV+ G    G+ L  P+PP AP+AVLG +Y C  PL Y++E ATL FPD++MQPFM+NT+KF+DAF+CIGFT+VPIWSGL VS +L+ GL +SI MI+DIKTMDRFE +RSKQLTITVSE
Sbjct:   43 GNLEGPFLFFGPRSLEKYKRTALRYLEQDDLMRIYGEQAAIVVFNNQDPVPLSSGYFPRLRKMLERQSVLVLPQDFLDVHPDYVSNETQVLTLQGAWSERDAQMTETFARLQDIYGPGRVLGVLGNSVSQSQTEYLGP--EGTEPGEWVEAGRVKREVTDAPRSTQLAAAVDDDKPAKVLPKYALYNATGPPGKAALLYSSGWPELQWADGSVTVLDTPIGEPTIKPTRLYTILVVRFADGDNTRDKITLEFSFKQSAGWWTAAGVEVRRG-RGAGIGLLPPAPPAAPAAVLGRAYSCPQPLVYAAENATLTFPDIMMQPFMENTQKFADAFDCIGFTSVPIWSGLMVSCILVLGLALSICMIMDIKTMDRFETSRSKQLTITVSE 425          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|910325032|ref|XP_013165613.1| (PREDICTED: uncharacterized protein LOC106116361 [Papilio xuthus])

HSP 1 Score: 548.895 bits (1413), Expect = 4.833e-180
Identity = 278/385 (72.21%), Postives = 320/385 (83.12%), Query Frame = 0
Query:   18 NLEGPFLFFGPESLEKYKRPALKNLDQDDLMRIYGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQ------GPSLEYSEPGSWARARREADASAEPP--------AEDEKPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGD-SRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            NLEGPFLFFGP SLEKYKR AL+ L+QDDLMRIYGE+AAIVVFNNQD VPL+SG FPRLRKMLE  + LVLPQDFLDVHPDY+SNETQ+LTLQGPWSERDAQMTETFARLQDIYG GRVLG+LGNSVSQ      GP  E +EPG W  A R      + P         +D+KP KVL ++ALYNATGPPG++ALLYS+GWPE++WA+GSVTVLDTP+GEPT+KPTRLYTILVVRFADGD +RDKITLEFSFKQSAGWW A GVEV+ G    G+ L  P+PP AP+AVLG +Y C  PL Y++E ATL FPD++MQPFM+NT+KF+DAF+CIGFT+VPIWSGL VS +L+ GL +SI MI+DIKTMDRFE +RSKQLTITVSE
Sbjct: 1107 NLEGPFLFFGPRSLEKYKRTALRYLEQDDLMRIYGEQAAIVVFNNQDPVPLSSGYFPRLRKMLERQSVLVLPQDFLDVHPDYVSNETQVLTLQGPWSERDAQMTETFARLQDIYGPGRVLGVLGNSVSQSQTEYLGP--EGTEPGEWVEAGRVKREVTDAPRSTQLAAAVDDDKPAKVLPKYALYNATGPPGKAALLYSSGWPELQWADGSVTVLDTPIGEPTIKPTRLYTILVVRFADGDNTRDKITLEFSFKQSAGWWTAAGVEVRRG-RGAGIGLLPPAPPAAPAAVLGRAYSCPQPLVYAAENATLTFPDIMMQPFMENTQKFADAFDCIGFTSVPIWSGLMVSCILVLGLALSICMIMDIKTMDRFETSRSKQLTITVSE 1488          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|943959541|ref|XP_014362395.1| (PREDICTED: uncharacterized protein LOC106713999 [Papilio machaon])

HSP 1 Score: 546.199 bits (1406), Expect = 4.957e-179
Identity = 277/385 (71.95%), Postives = 317/385 (82.34%), Query Frame = 0
Query:   18 NLEGPFLFFGPESLEKYKRPALKNLDQDDLMRIYGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQ------GPSLEYSEPGSWARARREADASAEPPAEDE--------KPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGD-SRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            NLEGPFLFFGP SLEKYKR AL+ L+QDDLMRIYGE+AAIVVFNNQD VPL+SG FPRLRKMLE  + LVLPQDFLDVHPDY+SNETQ+LTLQGPWSERDAQMTETFARLQDIYG GRVLG+LGNSVSQ      GP  E +E G W  A R    + + P   +        KP KVL ++ALYNATGPPG++ALLYS+GWPE++WA+GSVTVLDTP+GEPT+KPTRLYTILVVRFADGD +RDKITLEFSFKQSAGWW A GVEV  G    GL L  P+PP AP+AVLGH+Y C  PL Y+++ ATL FPD++MQPFM+NT+KF DAF+CIGFT+VPIWSGL VS +++ GL VSI MI+DIKTMDRFE +RSKQLTITVSE
Sbjct: 1107 NLEGPFLFFGPRSLEKYKRTALRYLEQDDLMRIYGEQAAIVVFNNQDPVPLSSGYFPRLRKMLERQSVLVLPQDFLDVHPDYVSNETQVLTLQGPWSERDAQMTETFARLQDIYGPGRVLGVLGNSVSQSQAEYLGP--EVTESGEWGEAGRVKREATDAPRSTQLAAAADDDKPAKVLPKYALYNATGPPGKAALLYSSGWPELQWADGSVTVLDTPIGEPTIKPTRLYTILVVRFADGDNTRDKITLEFSFKQSAGWWSAAGVEVTRG-RGVGLGLLPPAPPAAPAAVLGHAYSCPQPLVYAADNATLTFPDIMMQPFMENTQKFGDAFDCIGFTSVPIWSGLMVSCIMVLGLAVSICMIMDIKTMDRFETSRSKQLTITVSE 1488          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|909553086|ref|XP_013147959.1| (PREDICTED: uncharacterized protein LOC106110622 [Papilio polytes])

HSP 1 Score: 526.554 bits (1355), Expect = 8.984e-175
Identity = 272/383 (71.02%), Postives = 318/383 (83.03%), Query Frame = 0
Query:   18 NLEGPFLFFGPESLEKYKRPALKNLDQDDLMRIYGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQGPS----LEYSEPGSW---ARARREADASAE-----PPAEDEKPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGD-SRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            NLEGPFLFFGP +LEKY+R AL+ L+QDDLMRIYGE+ AIVVFNNQD+VPL+SG FPRLRKMLE LT + LPQDFLDVHPDY+SNETQ+L LQGPWSERDAQMTETFARLQDIYG GRVLG+LGNSVSQ  +    LE +E G W    R +REA  +       P A+D+KP KVL ++ALYNATGPPG++ALLYS+GWPE++W +GSVTVLDTP+GEPT+KPTRLYTILVVRFADGD +RDKITLEFSFKQSAGWW A GVEV+ G    GL L  P+PP AP+AVLG +Y C   L Y++E ATL FPD++MQPFM+NT+KF+DAF+CIGFT+VPIWSGL VS ++   L VS+ MI+DIKTMDRFE +RSKQLTITVSE
Sbjct:  768 NLEGPFLFFGPRTLEKYRRTALRALEQDDLMRIYGEQPAIVVFNNQDAVPLSSGYFPRLRKMLERLTVIALPQDFLDVHPDYVSNETQVLILQGPWSERDAQMTETFARLQDIYGPGRVLGVLGNSVSQSQAEFLGLEDAELGEWGEMGRVKREASEAPSSTQLVPAADDDKPAKVLPKYALYNATGPPGKAALLYSSGWPELQWPDGSVTVLDTPIGEPTIKPTRLYTILVVRFADGDNTRDKITLEFSFKQSAGWWSAAGVEVRRG-RGAGLGLLPPAPPAAPAAVLGRAYTCPQALVYAAENATLTFPDIMMQPFMENTQKFADAFDCIGFTSVPIWSGLMVSCIMALALAVSVCMIMDIKTMDRFETSRSKQLTITVSE 1149          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|930671351|gb|KPJ12104.1| (V-type proton ATPase subunit S1 [Papilio machaon])

HSP 1 Score: 494.582 bits (1272), Expect = 9.308e-173
Identity = 252/355 (70.99%), Postives = 290/355 (81.69%), Query Frame = 0
Query:   48 MRIYGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQ------GPSLEYSEPGSWARARREADASAEPPAEDE--------KPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGD-SRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            MRIYGE+AAIVVFNNQD VPL+SG FPRLRKMLE  + LVLPQDFLDVHPDY+SNETQ+LTLQGPWSERDAQMTETFARLQDIYG GRVLG+LGNSVSQ      GP  E +E G W  A R    + + P   +        KP KVL ++ALYNATGPPG++ALLYS+GWPE++WA+GSVTVLDTP+GEPT+KPTRLYTILVVRFADGD +RDKITLEFSFKQSAGWW A GVEV  G    GL L  P+PP AP+AVLGH+Y C  PL Y+++ ATL FPD++MQPFM+NT+KF DAF+CIGFT+VPIWSGL VS +++ GL VSI MI+DIKTMDRFE +RSKQLTITVSE
Sbjct:    1 MRIYGEQAAIVVFNNQDPVPLSSGYFPRLRKMLERQSVLVLPQDFLDVHPDYVSNETQVLTLQGPWSERDAQMTETFARLQDIYGPGRVLGVLGNSVSQSQAEYLGP--EVTESGEWGEAGRVKREATDAPRSTQLAAAADDDKPAKVLPKYALYNATGPPGKAALLYSSGWPELQWADGSVTVLDTPIGEPTIKPTRLYTILVVRFADGDNTRDKITLEFSFKQSAGWWSAAGVEVTRG-RGVGLGLLPPAPPAAPAAVLGHAYSCPQPLVYAADNATLTFPDIMMQPFMENTQKFGDAFDCIGFTSVPIWSGLMVSCIMVLGLAVSICMIMDIKTMDRFETSRSKQLTITVSE 352          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|768422849|ref|XP_011552301.1| (PREDICTED: uncharacterized protein LOC105383865, partial [Plutella xylostella])

HSP 1 Score: 445.277 bits (1144), Expect = 4.072e-154
Identity = 235/305 (77.05%), Postives = 261/305 (85.57%), Query Frame = 0
Query:   85 TLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQGPSLEYSEPGSWARARREADAS-AEPPAEDEKPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGD-SRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            TLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQ   + YS  G W RARR AD   +   AE E       ++ALYNATGPPG+ ALL+S+GWPE+RW +GS TVLDTPVGEPTVKPTRLYTILVVRFADGD +RDKITLEFSFKQS GWW AVGVEVK G+E TGLNL+AP+PP APSAVLG +Y CSLPL Y+SEEA+L  PDV+MQPFMD+TEKF+DAF+CIGFT+VPIWSGL V+ +LI  L +SI MILDIKTMDRFEN+R KQL+ITVSE
Sbjct:    1 TLVLPQDFLDVHPDYISNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQ--PVSYS-GGEW-RARRSADDDLSTTTAEPEYSAGGKNKYALYNATGPPGKGALLFSSGWPELRWPDGSATVLDTPVGEPTVKPTRLYTILVVRFADGDNTRDKITLEFSFKQSQGWWTAVGVEVKRGLESTGLNLQAPAPPQAPSAVLGRAYHCSLPLVYASEEASLTLPDVMMQPFMDSTEKFADAFDCIGFTSVPIWSGLMVTFLLILMLSISICMILDIKTMDRFENSRGKQLSITVSE 301          
BLAST of HiSeq12121 vs. genbank:protein
Match: gi|914575352|gb|KOB77455.1| (Uncharacterized protein OBRU01_03636, partial [Operophtera brumata])

HSP 1 Score: 300.056 bits (767), Expect = 1.797e-97
Identity = 158/262 (60.31%), Postives = 191/262 (72.90%), Query Frame = 0
Query:  151 EYSEPGS-WARARREAD--ASAEPPAEDEKPPKVLQRFALYNATGPPGRSALLYSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGDSRDKITLEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECSLPLEYSSEEATLLFPDVLMQPFMDNTEK---------FSDAFNCI---------GFTTVP----IWSGLFVSSMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE 387
            EY EP S W+R RR+A+   +   P E+EKP K L ++ALYNATGPPG+ ALL+S+GWPE+R+ANGS TVL TPVGEPTVKPTRLYTIL+VRFADGDSR+K TLEFSFKQS GWW AVGVEVKFG+E TGL+L AP PPDAPSAVLG SY C LPL YSSEEATL  PDV  Q  +  +E             +++C             T+P    I SGL V+ +++ G+ +SI+MI+DI+TMDRFE +RSKQLTITV+E
Sbjct:    2 EYLEPDSEWSRVRRQAEETTTTSSPQEEEKPAKALPKYALYNATGPPGKGALLFSSGWPELRFANGSSTVLSTPVGEPTVKPTRLYTILMVRFADGDSRNKTTLEFSFKQSGGWWTAVGVEVKFGLEITGLSLTAPGPPDAPSAVLGKSYHCPLPLVYSSEEATLTLPDV--QVILVESESGPPDAPSAVLGKSYHCPLPLVYSSEEATLTLPDVQVILSGLLVTFIMLIGIAISITMIMDIRTMDRFETSRSKQLTITVNE 261          
The following BLAST results are available for this feature:
BLAST of HiSeq12121 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357625267|gb|EHJ75768.1|0.000e+071.91hypothetical protein KGM_20044 [Danaus plexippus][more]
gi|768416777|ref|XP_011548992.1|0.000e+075.39PREDICTED: uncharacterized protein LOC105381050 [P... [more]
gi|827537403|ref|XP_012547044.1|0.000e+076.68PREDICTED: uncharacterized protein LOC101739289 [B... [more]
gi|930661020|gb|KPJ02962.1|0.000e+072.02V-type proton ATPase subunit S1 [Papilio xuthus][more]
gi|910325032|ref|XP_013165613.1|4.833e-18072.21PREDICTED: uncharacterized protein LOC106116361 [P... [more]
gi|943959541|ref|XP_014362395.1|4.957e-17971.95PREDICTED: uncharacterized protein LOC106713999 [P... [more]
gi|909553086|ref|XP_013147959.1|8.984e-17571.02PREDICTED: uncharacterized protein LOC106110622 [P... [more]
gi|930671351|gb|KPJ12104.1|9.308e-17370.99V-type proton ATPase subunit S1 [Papilio machaon][more]
gi|768422849|ref|XP_011552301.1|4.072e-15477.05PREDICTED: uncharacterized protein LOC105383865, p... [more]
gi|914575352|gb|KOB77455.1|1.797e-9760.31Uncharacterized protein OBRU01_03636, partial [Ope... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015991 ATP hydrolysis coupled proton transport
biological_process GO:0055114 oxidation-reduction process
biological_process GO:0006801 superoxide metabolic process
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0033180 proton-transporting V-type ATPase, V1 domain
molecular_function GO:0046872 metal ion binding
molecular_function GO:0046961 proton-transporting ATPase activity, rotational mechanism
molecular_function GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12471:SF4SUBFAMILY NOT NAMEDcoord: 1..387
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 18..342
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 366..387
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..4
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 343..365
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..17
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 14..17
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 5..13
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.552
NoneNo IPR availableTMHMMTMhelixcoord: 343..365
IPR008388ATPase, V1 complex, subunit S1PANTHERPTHR12471VACUOLAR ATP SYNTHASE SUBUNIT S1coord: 1..387

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12121HiSeq12121Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12121_p ID=HiSeq12121_p|Name=HiSeq12121|organism=Ostrinia scapulalis|type=polypeptide|length=387bp
MFPPVLLVLSYVLTVYGNLEGPFLFFGPESLEKYKRPALKNLDQDDLMRI
YGEEAAIVVFNNQDSVPLASGNFPRLRKMLEGLTTLVLPQDFLDVHPDYI
SNETQMLTLQGPWSERDAQMTETFARLQDIYGSGRVLGILGNSVSQGPSL
EYSEPGSWARARREADASAEPPAEDEKPPKVLQRFALYNATGPPGRSALL
YSTGWPEIRWANGSVTVLDTPVGEPTVKPTRLYTILVVRFADGDSRDKIT
LEFSFKQSAGWWQAVGVEVKFGVEPTGLNLKAPSPPDAPSAVLGHSYECS
LPLEYSSEEATLLFPDVLMQPFMDNTEKFSDAFNCIGFTTVPIWSGLFVS
SMLIAGLVVSISMILDIKTMDRFENNRSKQLTITVSE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006801superoxide metabolic process
GO:0055114oxidation-reduction process
GO:0015991ATP hydrolysis coupled proton transport
Vocabulary: Molecular Function
TermDefinition
GO:0046872metal ion binding
GO:0046933proton-transporting ATP synthase activity, rotational mechanism
GO:0046961proton-transporting ATPase activity, rotational mechanism
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO:0033180proton-transporting V-type ATPase, V1 domain
Vocabulary: INTERPRO
TermDefinition
IPR008388ATPase_V1-cplx_s1su