HiSeq12983_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12983
Unique NameHiSeq12983_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length338
Homology
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|913323205|ref|XP_013192863.1| (PREDICTED: fatty acid 2-hydroxylase [Amyelois transitella])

HSP 1 Score: 510.76 bits (1314), Expect = 4.230e-180
Identity = 237/337 (70.33%), Postives = 284/337 (84.27%), Query Frame = 0
Query:    5 KFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVK--DVNLTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSC-TDPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDPGSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKFVGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            +F V F G NYDIK+FLRDHPGGVNTLK ++GKSI  AM  +GHS+ AYHML+DFKV   DVNLTG VS NGRIITK E+ R+ +E+A LEELEARLDWSKP++ QLDAIAP Y+ WVNS VYR+CRLF+SPILESMTFTPW+LVP+ W+PIILYL  + F +YVACGD+C  D +    +L H+V GVGIW+A+EYSLHRWVFH +PG S+TMI++HFLIHG+HHK+PFDGLRQVFPP+ A++L  I+Y P  M   YP +K  GGL+GYLTYDMIHYYVHHGSP+DG+YLY MKRYHSNHHFVNHDKAFGI+SK+WD VF+T+VKV++LGFSLQW
Sbjct:    4 QFHVKFAGANYDIKQFLRDHPGGVNTLKNFRGKSILAAMQKFGHSSGAYHMLSDFKVSEVDVNLTGAVSENGRIITKGEAGRDWQEVAFLEELEARLDWSKPLLRQLDAIAPDYDTWVNSPVYRKCRLFESPILESMTFTPWFLVPMVWLPIILYLGVTQFRQYVACGDACPKDSILFSTYLLHVVCGVGIWTALEYSLHRWVFHRNPGKSVTMIRIHFLIHGMHHKVPFDGLRQVFPPVAAMVLTCIIYTPLQMVFTYPVIKLTGGLIGYLTYDMIHYYVHHGSPKDGTYLYSMKRYHSNHHFVNHDKAFGISSKLWDYVFKTFVKVRQLGFSLQW 340          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|909564810|ref|XP_013137684.1| (PREDICTED: fatty acid 2-hydroxylase [Papilio polytes])

HSP 1 Score: 492.271 bits (1266), Expect = 8.606e-173
Identity = 227/337 (67.36%), Postives = 285/337 (84.57%), Query Frame = 0
Query:    4 TKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVKDVN-LTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSC-TDPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDPGSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKFVGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            ++FPV FDG++YD++RFLRDHPGGVNTL++YKGKSI QAM  YGHS SAYHML DFKV ++  LTG VS+NGRIITKEE++R+ +EIA LEELE+RLDWSKPI  QL AI   Y+ WV+SAV+R CRLF +PI+ESMT+T WYLVP FWIPII+YL+ + + EYV CG +C +D L  +Q+L H++ G+ IW+ +EYSLHRWVFH  PGS++ +IK+HFLIHG+HHK+PFDGLRQVFPPIPA +LA +LY   + ++ YP +K +GGL+GYL YDMIHYYVHHGSP+DG+YLY MKRYHSNHHFVNHDKA+GI+SK+WD VF+T+V+VKKL FSL+W
Sbjct:    3 SEFPVAFDGRSYDLRRFLRDHPGGVNTLERYKGKSIAQAMKMYGHSNSAYHMLGDFKVGELGVLTGDVSSNGRIITKEEANRDEKEIAHLEELESRLDWSKPIFCQLGAIGSDYDKWVHSAVFRDCRLFANPIMESMTYTQWYLVPTFWIPIIIYLMVTTYGEYVNCGGACGSDRLTSLQYLLHLMSGILIWTILEYSLHRWVFHFSPGSNLILIKIHFLIHGIHHKVPFDGLRQVFPPIPAALLAFLLYNILYPFLSYPIMKLIGGLIGYLIYDMIHYYVHHGSPKDGTYLYAMKRYHSNHHFVNHDKAYGISSKIWDHVFKTFVQVKKLSFSLRW 339          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|910311947|ref|XP_013166857.1| (PREDICTED: fatty acid 2-hydroxylase [Papilio xuthus])

HSP 1 Score: 479.559 bits (1233), Expect = 8.509e-168
Identity = 224/341 (65.69%), Postives = 280/341 (82.11%), Query Frame = 0
Query:    1 MDPTKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVKDVN--LTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSCT-DPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDPGSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKFVGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            M    FPV FDG+ YD++RFL+DHPGGVNTL++YKGKSI QAM  +GHS SAYHML DFKV + N  LTG +S NGRIITKEE +R+ +EIA LEELE+RLDWS PI  QL AIA  Y+ WV+SAV+R CRLF +PI+ESMT+T WYLVP FW+PII+YL+ + + +YV CGDSC  D L  +Q++  ++ GV +W+ +EYSLHRWVFH +PGS++ +I++HFLIHG+HHK+PFDGLRQVFPPIPA +LA +LY   +  + YP +K +GGL+GYL YDMIHYYVHHGSP+DG+YLY MKRYHSNHHFVNHDKAFGI+SK+WD VF+T+V+VKKL FSL+W
Sbjct:    1 MGSDDFPVAFDGRRYDLRRFLKDHPGGVNTLERYKGKSITQAMKIFGHSNSAYHMLGDFKVGEENGVLTGDISGNGRIITKEEENRDEKEIAHLEELESRLDWSMPIFCQLGAIASDYDKWVHSAVFRNCRLFANPIMESMTYTQWYLVPTFWVPIIIYLMVTVYYQYVNCGDSCGPDSLTSLQYIQQLISGVLLWTILEYSLHRWVFHFNPGSNLNLIRVHFLIHGIHHKVPFDGLRQVFPPIPAALLAALLYFMLYPLVSYPIIKLIGGLIGYLIYDMIHYYVHHGSPKDGTYLYAMKRYHSNHHFVNHDKAFGISSKIWDHVFKTFVQVKKLSFSLRW 341          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|943956441|ref|XP_014361081.1| (PREDICTED: fatty acid 2-hydroxylase 2 [Papilio machaon])

HSP 1 Score: 468.774 bits (1205), Expect = 1.155e-163
Identity = 219/341 (64.22%), Postives = 275/341 (80.65%), Query Frame = 0
Query:    1 MDPTKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVKDVN--LTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSC-TDPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDPGSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKFVGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            M    FPV F G+ YD+ RFLRDHPGGVN+L++YKGKSI QAM  +GHS SAYHML DFKV +    LTG VS NGRIITKEE++R+ +EIA LEELE+RLD          AIA  Y+ WV+SAV+R CRLF +PI+ESMT+T WYLVP FWIPII+YL+ + + EYV CGDSC +D L  +Q++ H++ GV +W+ +EYSLHRWVFH +PGS++ +IK+HFLIHG+HHK+PFDGLRQVFPPIPA +LA ++Y   + ++ YP +K +GGL+GYL YDMIHYYVHHGSP+DG+YLY MKRYHSNHHFVNHDKA+GI+SK+WD VF+T+V+VKKL FSL+W
Sbjct:    1 MGSDDFPVAFGGRCYDLSRFLRDHPGGVNSLERYKGKSIAQAMKMFGHSNSAYHMLGDFKVGEEQGVLTGDVSGNGRIITKEEANRDEKEIAHLEELESRLD----------AIASDYDKWVHSAVFRDCRLFANPIMESMTYTQWYLVPTFWIPIIIYLMVTVYAEYVNCGDSCGSDSLTSLQYIQHLISGVLLWTILEYSLHRWVFHFNPGSNLFLIKIHFLIHGIHHKVPFDGLRQVFPPIPAALLATLIYYMLYPFVSYPIIKLIGGLIGYLIYDMIHYYVHHGSPKDGTYLYAMKRYHSNHHFVNHDKAYGISSKIWDHVFKTFVQVKKLSFSLRW 331          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|930657136|gb|KPI99457.1| (Fatty acid 2-hydroxylase [Papilio xuthus])

HSP 1 Score: 466.077 bits (1198), Expect = 2.191e-162
Identity = 220/342 (64.33%), Postives = 276/342 (80.70%), Query Frame = 0
Query:    1 MDPTKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVKDVN--LTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSCT-DPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDPGSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKFVGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKA-FGITSKVWDLVFQTYVKVKKLGFSLQW 338
            M    FPV FDG+ YD++RFL+DHPGGVNTL++YKGKSI QAM  +GHS SAYHML DFKV + N  LTG +S NGRIITKEE +R+ +EIA LEELE+RLDWS PI  QL AIA  Y+ WV+SAV+R CRLF +PI+ESMT+T WYLVP FW+PII+YL+ + + +YV CGDSC  D L  +Q++  ++ GV +W+ +EYSLHRWVFH +PGS++ +I++HFLIHG+HHK+PFDGLRQVFPPIPA +LA +LY   +  + YP +K +GGL+GYL YDMIHYYVHHGSP+DG+YLY MKRYHSNHHFVNHDK  +   SK+WD VF+T+V+VKKL FSL+W
Sbjct:    1 MGSDDFPVAFDGRRYDLRRFLKDHPGGVNTLERYKGKSITQAMKIFGHSNSAYHMLGDFKVGEENGVLTGDISGNGRIITKEEENRDEKEIAHLEELESRLDWSMPIFCQLGAIASDYDKWVHSAVFRNCRLFANPIMESMTYTQWYLVPTFWVPIIIYLMVTVYSQYVNCGDSCGPDSLTSLQYIQQLISGVLLWTILEYSLHRWVFHFNPGSNLNLIRVHFLIHGIHHKVPFDGLRQVFPPIPAALLAALLYFMLYPLVSYPIIKLIGGLIGYLIYDMIHYYVHHGSPKDGTYLYAMKRYHSNHHFVNHDKGKYQFFSKIWDHVFKTFVQVKKLSFSLRW 342          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|768437123|ref|XP_011560085.1| (PREDICTED: fatty acid 2-hydroxylase-like [Plutella xylostella])

HSP 1 Score: 465.307 bits (1196), Expect = 2.992e-162
Identity = 223/338 (65.98%), Postives = 267/338 (78.99%), Query Frame = 0
Query:    1 MDPTKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVKDVNLTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSCTDPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDPGSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKFVGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            M   +FPV FDG  YD++RFLRDHPGGVNTLK YKGKSI  AM  + HS SAYHML+DF+V D ++ G VSANGRIIT EE  R+ ++IA LEELE +LDWSKPI+ QL  +A HY+ WVNSAVYR CRLF SP+LE++T+TPWYLVP+ W+P+ILYL  + F ++V   D     + P+Q+L H+ +GV IWSAVEYSLHRWVFHLDPG S+ +IKLHF+IHGLHHK+PFD  RQVFPP+PA  LA   Y+ F     YP +K  GGL+GYLTYDMIH YVH GSP+ GSYLY MKRYHSNHHFVNHDKAFGI+SKVWDLVF+T V+V+KL F+LQW
Sbjct:    1 MTSQEFPVTFDGVQYDLQRFLRDHPGGVNTLKHYKGKSIVSAMQKFDHSASAYHMLSDFRV-DSSVRG-VSANGRIITSEEQGRDVKDIAFLEELEGKLDWSKPILGQLHLVAAHYDRWVNSAVYRPCRLFASPLLEALTYTPWYLVPLVWVPVILYLGCTQFAQHVFSEDPSLR-ISPLQYLCHVALGVAIWSAVEYSLHRWVFHLDPGRSVALIKLHFIIHGLHHKVPFDDYRQVFPPVPAAALAYGFYLFFSCIFSYPLIKMTGGLIGYLTYDMIHCYVHRGSPKAGSYLYSMKRYHSNHHFVNHDKAFGISSKVWDLVFRTIVQVRKLNFNLQW 335          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|827545053|ref|XP_012545109.1| (PREDICTED: uncharacterized protein LOC101737056 [Bombyx mori])

HSP 1 Score: 361.303 bits (926), Expect = 8.145e-115
Identity = 164/243 (67.49%), Postives = 202/243 (83.13%), Query Frame = 0
Query:   97 ARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSCTDP-LHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDPGSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKFVGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            +RLDWSKP++ QL AIAP YE WVNSAVYR+CRLF SP+LES+T+TPWY VP+FWIP+ILYL  + + E VACG+ CTD  +   Q++ ++ +GV +W+ +EYSLHRW+FHLDPGSS+ MIKLHFLIHG+HHK+PFDGLRQVFPPIPAL L  I+Y     ++ YP +   GGL+GYLTYDMIHYYVHHGSP+DG+YLY MKRYHSNHHF+NHDKA+GI+SK+WD VF+T   VKKL FSL+W
Sbjct:  603 SRLDWSKPLLCQLHAIAPDYEKWVNSAVYRKCRLFASPLLESLTYTPWYFVPMFWIPVILYLGWTQYYEQVACGEHCTDANITTFQYVYYISLGVLLWTILEYSLHRWIFHLDPGSSLIMIKLHFLIHGMHHKVPFDGLRQVFPPIPALGLTTIIYSALRPFLAYPVLVLTGGLIGYLTYDMIHYYVHHGSPKDGTYLYAMKRYHSNHHFLNHDKAYGISSKMWDHVFRTVAHVKKLSFSLRW 845          

HSP 2 Score: 227.639 bits (579), Expect = 2.282e-64
Identity = 116/172 (67.44%), Postives = 138/172 (80.23%), Query Frame = 0
Query:    6 FPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKV-----KDVNLTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDS 172
            FPV F  + YD+++FLRDHPGGVNTL+ YKGKSI QAM  +GHSTSAYH++ D KV     KDVNLTG VS NGRI+T E+S R+ EEI  LEELE+RLDWSKP++ QL AIAP YE WVNSAVYR+CRLF SP+LES+T+TPWY VP+FWIP+ILYL  + + E VACG S
Sbjct:  427 FPVKFKEECYDLQKFLRDHPGGVNTLQMYKGKSILQAMQKFGHSTSAYHLMKDLKVDGDVLKDVNLTGGVSENGRILTNEDSMRDPEEIEFLEELESRLDWSKPLLCQLHAIAPDYEKWVNSAVYRKCRLFASPLLESLTYTPWYFVPMFWIPVILYLGWTQYYEQVACGVS 598          

HSP 3 Score: 115.546 bits (288), Expect = 8.633e-25
Identity = 55/85 (64.71%), Postives = 66/85 (77.65%), Query Frame = 0
Query:    6 FPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKV-----KDVNLTGKVSANGRIITKEESSRN 85
            FPV F  + YD+++FLRDHPGGVNTL+ YKGKSI QAM  +GHSTSAYH++ D KV     KDVNLTG VS NGRI+T E+S R+
Sbjct:  309 FPVKFKEECYDLQKFLRDHPGGVNTLQMYKGKSILQAMQKFGHSTSAYHLMKDLKVDGDVLKDVNLTGGVSENGRILTNEDSMRD 393          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|1130208106|ref|XP_019753756.1| (PREDICTED: fatty acid 2-hydroxylase [Dendroctonus ponderosae] >gi|1130208109|ref|XP_019753757.1| PREDICTED: fatty acid 2-hydroxylase [Dendroctonus ponderosae] >gi|1130208113|ref|XP_019753758.1| PREDICTED: fatty acid 2-hydroxylase [Dendroctonus ponderosae] >gi|478262113|gb|ENN81003.1| hypothetical protein YQE_02587, partial [Dendroctonus ponderosae])

HSP 1 Score: 290.812 bits (743), Expect = 8.708e-94
Identity = 152/340 (44.71%), Postives = 213/340 (62.65%), Query Frame = 0
Query:    2 DPTKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVKDVNLTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSCTDPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDP-GSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKF--VGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            D   F V ++   YD+++FL++HPGG+N L  YKGK I + M    HS +A+++  ++K KD                +    N +E    E+ E  +DW KP+++Q+ ++   Y+ WV S V R  RLF +PILE+++ TPWY+VPV WIPII++L+     +YV      T+    I ++G   +G+  WS +EYSLHRWVFH++P G S  MI LHF IHGLHHK+PFD  R VFPP PA I+A  LY  F   +P   +     GGL+GY+TYDMIH+Y+H+GSPR+ SY Y +KRYH+ HHF +HD  FGI+S  WD VF T + ++KLG S+ W
Sbjct:    4 DQESFGVLYENDKYDLQQFLQNHPGGLNYLAPYKGKDISKRMQDSQHSRAAFYLFKEYK-KD---------------GKRKPANGDE----EDFEKLVDWDKPMLAQVGSLGTQYKEWVISPVDRNLRLFGNPILENLSITPWYVVPVIWIPIIMFLIQIGAQQYVETTKD-TNRAGIILYVG---LGIIAWSLMEYSLHRWVFHMEPSGYSKLMIYLHFAIHGLHHKVPFDTRRLVFPPFPAAIIALTLYKAFSFILPESIIVLFVAGGLVGYVTYDMIHFYLHYGSPRENSYFYNLKRYHNQHHFAHHDSGFGISSIFWDKVFGTAINLRKLGMSIIW 319          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|332374346|gb|AEE62314.1| (unknown [Dendroctonus ponderosae])

HSP 1 Score: 289.656 bits (740), Expect = 2.318e-93
Identity = 152/340 (44.71%), Postives = 213/340 (62.65%), Query Frame = 0
Query:    2 DPTKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVKDVNLTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSCTDPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDP-GSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKF--VGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            D   F V ++   YD+++FL++HPGG+N L  YKGK I + M    HS +A+++  ++K KD     +  ANG                  E+ E  +DW KP+++Q+ ++   Y+ WV S V R  RLF +PILE+++ TPWY+VPV WIPII++L+     +YV      T+    I ++G   +G+  WS +EYSLHRWVFH++P G S  MI LHF IHGLHHK+PFD  R VFPP PA ++A  LY  F   +P   +     GGL+GY+TYDMIH+Y+H+GSPR+ SY Y +KRYH+ HHF +HD  FGI+S  WD VF T + ++KLG S+ W
Sbjct:    4 DQESFGVLYENDKYDLQQFLQNHPGGLNYLAPYKGKDISKRMQDSQHSRAAFYLFKEYK-KD---GKRKQANGD----------------GEDFEKLVDWDKPMLAQVGSLGTQYKEWVISPVDRNLRLFGNPILENLSITPWYVVPVIWIPIIMFLIQIGAQQYVETTKD-TNRAGIILYVG---LGIIAWSLMEYSLHRWVFHMEPSGYSKLMIYLHFAIHGLHHKVPFDTRRLVFPPFPAAVIALTLYKAFSFILPESIIVLFVAGGLVGYVTYDMIHFYLHYGSPRENSYFYNLKRYHNQHHFAHHDSGFGISSIFWDKVFGTAINLRKLGMSIIW 319          
BLAST of HiSeq12983 vs. genbank:protein
Match: gi|546678521|gb|ERL89118.1| (hypothetical protein D910_06495 [Dendroctonus ponderosae])

HSP 1 Score: 289.271 bits (739), Expect = 4.402e-93
Identity = 152/340 (44.71%), Postives = 213/340 (62.65%), Query Frame = 0
Query:    2 DPTKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHSTSAYHMLNDFKVKDVNLTGKVSANGRIITKEESSRNAEEIAMLEELEARLDWSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVFWIPIILYLLASNFLEYVACGDSCTDPLHPIQFLGHMVMGVGIWSAVEYSLHRWVFHLDP-GSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGILYIPFWMWIPYPEVKF--VGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYHSNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW 338
            D   F V ++   YD+++FL++HPGG+N L  YKGK I + M    HS +A+++  ++K KD     +  ANG                  E+ E  +DW KP+++Q+ ++   Y+ WV S V R  RLF +PILE+++ TPWY+VPV WIPII++L+     +YV      T+    I ++G   +G+  WS +EYSLHRWVFH++P G S  MI LHF IHGLHHK+PFD  R VFPP PA I+A  LY  F   +P   +     GGL+GY+TYDMIH+Y+H+GSP++ SY Y +KRYH+ HHF +HD  FGI+S  WD VF T + ++KLG S+ W
Sbjct:    4 DQESFGVLYESDKYDLQQFLQNHPGGLNYLAPYKGKDISKRMQDSQHSRAAFYLFKEYK-KD---GKRKQANGD----------------GEDFEKLVDWDKPMLAQVGSLGTQYKEWVISPVDRNLRLFGNPILENLSITPWYVVPVIWIPIIMFLIQIGAQQYVETTKD-TNRAGIILYVG---LGIIAWSLMEYSLHRWVFHMEPSGYSKLMIYLHFAIHGLHHKVPFDTRRLVFPPFPAAIIALTLYKAFSFILPESVIVLFVAGGLVGYVTYDMIHFYLHYGSPKENSYFYNLKRYHNQHHFAHHDSGFGISSIFWDKVFGTAINLRKLGMSIIW 319          
The following BLAST results are available for this feature:
BLAST of HiSeq12983 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913323205|ref|XP_013192863.1|4.230e-18070.33PREDICTED: fatty acid 2-hydroxylase [Amyelois tran... [more]
gi|909564810|ref|XP_013137684.1|8.606e-17367.36PREDICTED: fatty acid 2-hydroxylase [Papilio polyt... [more]
gi|910311947|ref|XP_013166857.1|8.509e-16865.69PREDICTED: fatty acid 2-hydroxylase [Papilio xuthu... [more]
gi|943956441|ref|XP_014361081.1|1.155e-16364.22PREDICTED: fatty acid 2-hydroxylase 2 [Papilio mac... [more]
gi|930657136|gb|KPI99457.1|2.191e-16264.33Fatty acid 2-hydroxylase [Papilio xuthus][more]
gi|768437123|ref|XP_011560085.1|2.992e-16265.98PREDICTED: fatty acid 2-hydroxylase-like [Plutella... [more]
gi|827545053|ref|XP_012545109.1|8.145e-11567.49PREDICTED: uncharacterized protein LOC101737056 [B... [more]
gi|1130208106|ref|XP_019753756.1|8.708e-9444.71PREDICTED: fatty acid 2-hydroxylase [Dendroctonus ... [more]
gi|332374346|gb|AEE62314.1|2.318e-9344.71unknown [Dendroctonus ponderosae][more]
gi|546678521|gb|ERL89118.1|4.402e-9344.71hypothetical protein D910_06495 [Dendroctonus pond... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0009058 biosynthetic process
biological_process GO:0006633 fatty acid biosynthetic process
biological_process GO:0006631 fatty acid metabolic process
biological_process GO:0055114 oxidation-reduction process
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0080132 fatty acid alpha-hydroxylase activity
molecular_function GO:0020037 heme binding
molecular_function GO:0005506 iron ion binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0016833 oxo-acid-lyase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001199Cytochrome b5-like heme/steroid binding domainPFAMPF00173Cyt-b5coord: 10..61
e-value: 2.7E-7
score: 30.1
IPR001199Cytochrome b5-like heme/steroid binding domainGENE3D3.10.120.10coord: 8..63
e-value: 5.9E-12
score: 44.8
IPR001199Cytochrome b5-like heme/steroid binding domainPROSITEPS50255CYTOCHROME_B5_2coord: 10..65
score: 14.788
IPR001199Cytochrome b5-like heme/steroid binding domainSUPERFAMILY55856Cytochrome b5-like heme/steroid binding domaincoord: 5..65
IPR006694Fatty acid hydroxylasePFAMPF04116FA_hydroxylasecoord: 187..305
e-value: 1.0E-12
score: 48.3
IPR014430Sterol desaturase Scs7PIRSFPIRSF005149IPC-B_HDcoord: 3..338
e-value: 9.6E-90
score: 299.0
IPR006805Anthranilate synthase component I, N-terminalPFAMPF04715Anth_synt_I_Ncoord: 230..282
e-value: 1.2E-4
score: 21.9
NoneNo IPR availablePANTHERPTHR12863FATTY ACID HYDROXYLASEcoord: 8..326
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 264..282
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 237..258
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 201..236
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 161..179
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..140
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 283..338
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 259..263
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 180..200
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 141..160
NoneNo IPR availableTMHMMTMhelixcoord: 141..163
NoneNo IPR availableTMHMMTMhelixcoord: 237..259
IPR018506Cytochrome b5, heme-binding sitePROSITEPS00191CYTOCHROME_B5_1coord: 20..27

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12983HiSeq12983Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12983_p ID=HiSeq12983_p|Name=HiSeq12983|organism=Ostrinia scapulalis|type=polypeptide|length=338bp
MDPTKFPVHFDGKNYDIKRFLRDHPGGVNTLKKYKGKSIEQAMSAYGHST
SAYHMLNDFKVKDVNLTGKVSANGRIITKEESSRNAEEIAMLEELEARLD
WSKPIVSQLDAIAPHYEMWVNSAVYRRCRLFQSPILESMTFTPWYLVPVF
WIPIILYLLASNFLEYVACGDSCTDPLHPIQFLGHMVMGVGIWSAVEYSL
HRWVFHLDPGSSITMIKLHFLIHGLHHKMPFDGLRQVFPPIPALILAGIL
YIPFWMWIPYPEVKFVGGLMGYLTYDMIHYYVHHGSPRDGSYLYVMKRYH
SNHHFVNHDKAFGITSKVWDLVFQTYVKVKKLGFSLQW
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0020037heme binding
GO:0016833oxo-acid-lyase activity
GO:0080132fatty acid alpha-hydroxylase activity
GO:0005506iron ion binding
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0009058biosynthetic process
GO:0006631fatty acid metabolic process
GO:0006633fatty acid biosynthetic process
GO:0055114oxidation-reduction process
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR018506Cyt_B5_heme-BS
IPR006805Anth_synth_I_N
IPR014430Scs7
IPR006694Fatty_acid_hydroxylase
IPR001199Cyt_B5-like_heme/steroid-bd