HiSeq12989_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq12989
Unique NameHiSeq12989_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length213
Homology
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|914559228|gb|KOB66999.1| (putative zinc finger protein Kr18 [Operophtera brumata])

HSP 1 Score: 180.644 bits (457), Expect = 2.174e-53
Identity = 99/186 (53.23%), Postives = 120/186 (64.52%), Query Frame = 0
Query:   27 SIKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDYDNLDSEDEPLSLTKKKRRXNLQKREKKPTPVKRKTKVKQPQDESWECGECGARGAAGG 212
            +IK+E+ V VK EP ECLVC VRS DSY++ CT+T A G  LH FL++FT  +L SA   PKYVCK+C DLINVLEQAEIEY K+KETFE+++SKNPLF+++   PI+L SVKNEL               DSEDEPL+ TKKK      +  +  T V  K K       SWEC EC A G  GG
Sbjct:   22 NIKEEIGVTVKLEPLECLVCVVRSSDSYELQCTRTLALGTPLHDFLARFTQVELSSAGPCPKYVCKTCVDLINVLEQAEIEYLKIKETFETLLSKNPLFELTIPHPIKLSSVKNELFKAGRAEG-------DSEDEPLARTKKKHNKGFMQSSRN-TSVSNKFKCC-----SWECDECEAHGEEGG 194          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|913328520|ref|XP_013195775.1| (PREDICTED: putative uncharacterized zinc finger protein 814 [Amyelois transitella])

HSP 1 Score: 184.111 bits (466), Expect = 1.883e-51
Identity = 105/218 (48.17%), Postives = 145/218 (66.51%), Query Frame = 0
Query:    1 MAESAGQSENTGQHNDLLT--TKEDLVISIKKEVEV---LVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDYDNLDSEDEPLSLTKKKRRXNLQKREKKPTPVKRKTKVKQPQDESWECGECGARGAAGGA 213
            MAE++  +     H+ L+   TK D    IKKEVEV   LVKPEP EC+VC  RS++++++  T T+ SG SLH+FLSKFTN +    Q   +Y+CK+C DL+N+LE+AEIEY KLK+TFE+IISKNPLF +   QP+RL++VKNEL  Q+ + +  D ++ DSE+EPL + KKKR   + KR+K  +  K ++K    +  SWEC ECG  G  G  
Sbjct:    1 MAETSAMN----SHDKLVQYGTKRDENKEIKKEVEVPVPLVKPEPPECVVCVKRSQENFNIHNTHTNVSGISLHAFLSKFTNTEFPFPQNFVRYICKTCLDLVNILEEAEIEYLKLKQTFETIISKNPLFYLP--QPLRLDTVKNEL--QDNDTACADLND-DSENEPLVVIKKKRGQKVGKRKKALSKRKSESKPNNEESGSWECSECGVCGEGGAV 209          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|357629516|gb|EHJ78237.1| (putative zinc finger protein Kr18 [Danaus plexippus])

HSP 1 Score: 174.096 bits (440), Expect = 2.605e-48
Identity = 100/195 (51.28%), Postives = 130/195 (66.67%), Query Frame = 0
Query:   18 LTTKEDLVISIKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDYDNLDSEDEPLSLTKKKRRXNLQKREKKPTPVKRKTKVKQPQDESWECGECGARGAAGG 212
            +  +E + + +K E EV+VK E  ECLVC  RS +  D+    TS SG SL  FL KFTN+DL  +  + K+VCK+C +L+NVLEQAEIEY KLKE F+SII+KNPLF+ S    + LES+KNE        S  + DN DSEDEPL+LTKKKR   + KR+KK +    K KV   ++E WECGEC A+G++GG
Sbjct:   16 ILVQEHVQLGVKLETEVIVKQEVVECLVCLGRSGEHCDLSTANTS-SGTSLQDFLCKFTNSDLSKSTVSSKFVCKTCLNLVNVLEQAEIEYIKLKEEFKSIINKNPLFESSLQDDVSLESIKNE-----CLESVAENDN-DSEDEPLALTKKKRHRKVDKRKKK-SMTDVKHKVVSKENEGWECGECSAQGSSGG 202          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|909554028|ref|XP_013148468.1| (PREDICTED: zinc finger protein 93-like, partial [Papilio polytes])

HSP 1 Score: 167.933 bits (424), Expect = 3.417e-47
Identity = 101/217 (46.54%), Postives = 137/217 (63.13%), Query Frame = 0
Query:    1 MAESAGQSENTGQHNDLLTTKEDLVISIKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDY---DNLDSEDEPLSLTKKKRRXNLQKREKKPTP-VKRKTKVKQPQDESWECGECGARGAAGGA 213
            MAE +  +  +G +++  + + D    IK+EVEV VK EP +CLVCA R  D Y++  TKT  S  +L+ FL K +   L   +  PKYVCK+C+DL+N LE+AE EY KLK+TFE+II+KNPLF   +     L +VKNE+     +  +DD    DN DSEDEPL+LTK KR+  + KR KK +  VKR+ + K  +D SWEC  CG  G +GGA
Sbjct:    1 MAELSAMNSGSGANDEDNSKRNDF---IKQEVEVPVKREPVDCLVCADRHADGYEIHNTKTVVSNITLYEFLCKLSQATLTHCENYPKYVCKTCYDLVNELERAEKEYKKLKDTFEAIINKNPLFDCRTSSS--LCTVKNEV----FDIVYDDLCKTDN-DSEDEPLALTKHKRQRKVDKRRKKSSAEVKRRKRHKVDKD-SWECNICGLVGPSGGA 206          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|910353927|ref|XP_013181002.1| (PREDICTED: zinc finger protein 729-like, partial [Papilio xuthus])

HSP 1 Score: 163.31 bits (412), Expect = 7.570e-44
Identity = 99/217 (45.62%), Postives = 137/217 (63.13%), Query Frame = 0
Query:    1 MAESAGQSENTGQHNDLLTTKEDLVISIKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDY---DNLDSEDEPLSLTKKKRRXNLQKREKKPT-PVKRKTKVKQPQDESWECGECGARGAAGGA 213
            MAE +  +  +G +++  + + D    IK+EVE+ VK EP +CLVCA RS D +++  TKT  S  +L+ FL K +   L S +   KYVCK+C+DL+N LE+AE EY KLK+TFE+II+KNPLF   +     L  VKNE+      + +DD    DN DSEDEPL+LTK KR+  + KR+KK +  VKR+ + K  +D SWEC  CG  G +GG 
Sbjct:    1 MAELSAMNSGSGANDEENSQRNDF---IKQEVEIPVKREPVDCLVCADRSADGFEIHSTKTLVSNITLYEFLCKLSQATLTSCENYSKYVCKTCYDLVNELERAEKEYKKLKDTFEAIINKNPLFDCRTSSS-NLCMVKNEV----FESVYDDLCKTDN-DSEDEPLALTKHKRQRKVDKRKKKSSGEVKRRKRHKVNKD-SWECNLCGLVGPSGGT 207          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|930656828|gb|KPI99151.1| (Zinc finger protein 287 [Papilio xuthus])

HSP 1 Score: 163.31 bits (412), Expect = 2.027e-43
Identity = 99/216 (45.83%), Postives = 137/216 (63.43%), Query Frame = 0
Query:    1 MAESAGQSENTGQHNDLLTTKEDLVISIKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDY---DNLDSEDEPLSLTKKKRRXNLQKREKKPT-PVKRKTKVKQPQDESWECGECGARGAAGG 212
            MAE +  +  +G +++  + + D    IK+EVE+ VK EP +CLVCA RS D +++  TKT  S  +L+ FL K +   L S +   KYVCK+C+DL+N LE+AE EY KLK+TFE+II+KNPLF   +     L  VKNE+      + +DD    DN DSEDEPL+LTK KR+  + KR+KK +  VKR+ + K  +D SWEC  CG  G +GG
Sbjct:    1 MAELSAMNSGSGANDEENSQRNDF---IKQEVEIPVKREPVDCLVCADRSADGFEIHSTKTVVSNITLYEFLCKLSQATLTSCENYSKYVCKTCYDLVNELERAEKEYKKLKDTFEAIINKNPLFDCRTSSS-NLCMVKNEV----FESVYDDLCKTDN-DSEDEPLALTKHKRQRKVDKRKKKSSGEVKRRKRHKVNKD-SWECNLCGLVGPSGG 206          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|943966405|ref|XP_014365258.1| (PREDICTED: zinc finger protein 729 [Papilio machaon])

HSP 1 Score: 157.918 bits (398), Expect = 1.244e-41
Identity = 93/189 (49.21%), Postives = 123/189 (65.08%), Query Frame = 0
Query:   28 IKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDY---DNLDSEDEPLSLTKKKRRXNLQKREKKPTP-VKRKTKVKQPQDESWECGECGARGAAGG 212
            IK+EVEV VK EP +CLVCA RS D +++  TKT  S  +L+ FL   +   L S +   KYVCK+C+DL+N LE+AE EY KLK+TFE+II+KNPLF   +     L +VKNE+      + +DD    DN DSEDEPL+LTK KR+  + KR+KK +  VKR+ + K  +D SWEC  CG    +GG
Sbjct:   25 IKQEVEVPVKREPVDCLVCADRSADGFEIHSTKTVVSNVTLYEFLCNLSQATLTSCENYSKYVCKTCYDLVNELERAEKEYKKLKDTFEAIINKNPLFDCRTSSS-NLCTVKNEV----FESVYDDLCKTDN-DSEDEPLALTKHKRQRKVDKRKKKSSAEVKRRKRHKVNKD-SWECNICGLVSPSGG 206          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|930669016|gb|KPJ09982.1| (Zinc finger protein 681 [Papilio machaon])

HSP 1 Score: 156.762 bits (395), Expect = 5.650e-41
Identity = 93/189 (49.21%), Postives = 123/189 (65.08%), Query Frame = 0
Query:   28 IKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDY---DNLDSEDEPLSLTKKKRRXNLQKREKKPTP-VKRKTKVKQPQDESWECGECGARGAAGG 212
            IK+EVEV VK EP +CLVCA RS D +++  TKT  S  +L+ FL   +   L S +   KYVCK+C+DL+N LE+AE EY KLK+TFE+II+KNPLF   +     L +VKNE+      + +DD    DN DSEDEPL+LTK KR+  + KR+KK +  VKR+ + K  +D SWEC  CG    +GG
Sbjct:   25 IKQEVEVPVKREPVDCLVCADRSADGFEIHSTKTVVSNVTLYEFLCNLSQATLTSCENYSKYVCKTCYDLVNELERAEKEYKKLKDTFEAIINKNPLFDCRTSSS-NLCTVKNEV----FESVYDDLCKTDN-DSEDEPLALTKHKRQRKVDKRKKKSSAEVKRRKRHKVNKD-SWECNICGLVSPSGG 206          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|827542618|ref|XP_012544365.1| (PREDICTED: zinc finger protein 98-like [Bombyx mori])

HSP 1 Score: 152.525 bits (384), Expect = 1.100e-39
Identity = 95/199 (47.74%), Postives = 128/199 (64.32%), Query Frame = 0
Query:   26 ISIKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELG----------GQNINASFDDYDNLDSEDEPLSLTKKKRRXNLQKR--EKKPTPVKRKTKVKQPQDESWECGECGARGAAGG 212
            + IKKEV  +VKPEP ECLVC  RS+D YD++ T T+ASG SL +FL+KFT  D+  A ++ K+VCK+C DLIN+L+QAEIEY KLKE FE+IISKNPLF  S+V P++L +VK E              +++  F++ +  DSEDEPL   K+KR+  ++K     K TP  +K       + SW+C  CG  G  GG
Sbjct:   23 VGIKKEV--VVKPEPCECLVCVTRSQDCYDIYTTNTTASGTSLLTFLAKFTQTDITDAVKSSKHVCKNCLDLINILDQAEIEYVKLKEAFEAIISKNPLFVSSNV-PLKLTTVKAEYNDDEDDDDDDDDDDVSVHFNNLEE-DSEDEPLVKCKRKRKVQVKKNCTTAKHTPNSKKF------EGSWKCELCGETGDKGG 211          
BLAST of HiSeq12989 vs. genbank:protein
Match: gi|913312601|ref|XP_013187035.1| (PREDICTED: zinc finger protein 271-like [Amyelois transitella])

HSP 1 Score: 117.087 bits (292), Expect = 1.021e-26
Identity = 65/139 (46.76%), Postives = 90/139 (64.75%), Query Frame = 0
Query:   27 SIKKEV-EVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINASFDDYDNLDSEDEPL 164
            SIK+EV + +  P+P EC+VC   S ++YD+F TKTS+    LH+FLSKFTN +L   +   KY+CK+C DL+N LEQAEI Y +LK  FE IISKNPLF +  +    L+SV+ + GG +           DS+++PL
Sbjct:  523 SIKEEVSDPIDNPQPPECVVCVAESSENYDIFTTKTSSLKTPLHTFLSKFTNTELPFDRNLTKYICKTCLDLVNELEQAEIVYIQLKSDFEFIISKNPLFHL-PMSISGLKSVRRDSGGSS-----------DSDNQPL 649          

HSP 2 Score: 91.2781 bits (225), Expect = 9.986e-18
Identity = 46/107 (42.99%), Postives = 69/107 (64.49%), Query Frame = 0
Query:   22 EDLVISIKKEVEVLVKPEPHECLVCAVRSKDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINVLEQAEIEYNKLKETFESIISKNPLFQMS 128
            +D+ +S++K     VK E +ECL+C  ++ +  D+  T T+ SG  L+ +L KFTN +L   Q   K++C +C +L+N LE+AE+EY  LK+ FE IIS NPLF  S
Sbjct:   18 QDIEVSVEK-----VKCESNECLICVTQNTECKDIHNTNTNLSGTPLYEYLLKFTNTNLLYCQSYAKHICNTCLNLVNDLEKAELEYLTLKDNFELIISNNPLFNSS 119          
The following BLAST results are available for this feature:
BLAST of HiSeq12989 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 13
Match NameE-valueIdentityDescription
gi|914559228|gb|KOB66999.1|2.174e-5353.23putative zinc finger protein Kr18 [Operophtera bru... [more]
gi|913328520|ref|XP_013195775.1|1.883e-5148.17PREDICTED: putative uncharacterized zinc finger pr... [more]
gi|357629516|gb|EHJ78237.1|2.605e-4851.28putative zinc finger protein Kr18 [Danaus plexippu... [more]
gi|909554028|ref|XP_013148468.1|3.417e-4746.54PREDICTED: zinc finger protein 93-like, partial [P... [more]
gi|910353927|ref|XP_013181002.1|7.570e-4445.62PREDICTED: zinc finger protein 729-like, partial [... [more]
gi|930656828|gb|KPI99151.1|2.027e-4345.83Zinc finger protein 287 [Papilio xuthus][more]
gi|943966405|ref|XP_014365258.1|1.244e-4149.21PREDICTED: zinc finger protein 729 [Papilio machao... [more]
gi|930669016|gb|KPJ09982.1|5.650e-4149.21Zinc finger protein 681 [Papilio machaon][more]
gi|827542618|ref|XP_012544365.1|1.100e-3947.74PREDICTED: zinc finger protein 98-like [Bombyx mor... [more]
gi|913312601|ref|XP_013187035.1|1.021e-2646.76PREDICTED: zinc finger protein 271-like [Amyelois ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005634 nucleus
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 94..122
IPR012934Zinc finger, AD-typePFAMPF07776zf-ADcoord: 43..100
e-value: 6.8E-5
score: 22.6

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq12989HiSeq12989Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq12989_p ID=HiSeq12989_p|Name=HiSeq12989|organism=Ostrinia scapulalis|type=polypeptide|length=213bp
MAESAGQSENTGQHNDLLTTKEDLVISIKKEVEVLVKPEPHECLVCAVRS
KDSYDVFCTKTSASGASLHSFLSKFTNNDLGSAQQTPKYVCKSCFDLINV
LEQAEIEYNKLKETFESIISKNPLFQMSSVQPIRLESVKNELGGQNINAS
FDDYDNLDSEDEPLSLTKKKRRXNLQKREKKPTPVKRKTKVKQPQDESWE
CGECGARGAAGGA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
Vocabulary: INTERPRO
TermDefinition
IPR012934Znf_AD