HiSeq13006_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13006
Unique NameHiSeq13006_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length128
Homology
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|913328866|ref|XP_013195966.1| (PREDICTED: vacuolar protein sorting-associated protein 13D, partial [Amyelois transitella])

HSP 1 Score: 119.013 bits (297), Expect = 1.174e-28
Identity = 63/94 (67.02%), Postives = 67/94 (71.28%), Query Frame = 0
Query:   34 GSAADPTATSGPAAPAWGAAPTGRGSTGPGWGSSGPGWAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            G+   P +      P WGA      S+ PG    G GWA PG+VDSEALIAVELC VKGEGDSEDL IANILFNNLDIIANQETIVELIGF QR
Sbjct: 1224 GTKNIPDSDRSSPQPRWGAP----SSSQPGPHHPGLGWAPPGVVDSEALIAVELCLVKGEGDSEDLRIANILFNNLDIIANQETIVELIGFVQR 1313          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|357625327|gb|EHJ75807.1| (hypothetical protein KGM_07583 [Danaus plexippus])

HSP 1 Score: 119.013 bits (297), Expect = 1.513e-28
Identity = 68/128 (53.12%), Postives = 85/128 (66.41%), Query Frame = 0
Query:   12 IERTSP--LPNWSSGSTWSIGSPPGSAADPTATSGPAAPAWGAAP----------TGRGSTGPGWGSSGPGWAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            ++R +P    +W++G  W+      S     ATSG A  ++G +           + RG++  G+G  G  W APG+VDSEALIAVELCFVKGEGD+EDL IANILFNNLD+IANQETIVELIGFA R
Sbjct: 1060 VDRATPSAAADWANGICWN------SVNTSFATSGAAWTSFGQSLGNCWTGVGQGSRRGASAGGFGQEG-CWVAPGLVDSEALIAVELCFVKGEGDAEDLRIANILFNNLDVIANQETIVELIGFAHR 1180          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|914573558|gb|KOB76063.1| (Uncharacterized protein OBRU01_06385 [Operophtera brumata])

HSP 1 Score: 117.087 bits (292), Expect = 2.565e-28
Identity = 65/115 (56.52%), Postives = 75/115 (65.22%), Query Frame = 0
Query:   15 TSPLPNWSSGSTWSIGSPPGSAADPTATSGPAAPAWGAAPTGRGST--GPGWGSSGPGWAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            TSP+P+W SG+T +                    AWGA P    +T     +G + P W A G+VDSEALIAVELC VKGEG+SEDL IANILFNNLDIIANQETIVEL+GF QR
Sbjct:  285 TSPVPSWISGTTNN------------------NQAWGANPALGNTTWGNTTFGGNVPTWGAAGLVDSEALIAVELCLVKGEGESEDLRIANILFNNLDIIANQETIVELLGFTQR 381          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|930671500|gb|KPJ12217.1| (Vacuolar protein sorting-associated protein 13D [Papilio machaon])

HSP 1 Score: 109.383 bits (272), Expect = 3.070e-25
Identity = 51/64 (79.69%), Postives = 57/64 (89.06%), Query Frame = 0
Query:   64 WGSSGPGWAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            WG  G GW+APG+VD+EALIAVE+C VKG+ DSEDL IANILFNNLD+IANQETIVELIGFA R
Sbjct: 1090 WGG-GNGWSAPGLVDTEALIAVEICLVKGDADSEDLRIANILFNNLDVIANQETIVELIGFAHR 1152          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|1073543049|gb|JAT88636.1| (hypothetical protein g.18979, partial [Pectinophora gossypiella])

HSP 1 Score: 98.9821 bits (245), Expect = 2.301e-24
Identity = 46/49 (93.88%), Postives = 46/49 (93.88%), Query Frame = 0
Query:   79 SEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            SEALIAVELC VKGEGDSEDL IANILFNNLDIIANQETIVELIGF QR
Sbjct:    1 SEALIAVELCLVKGEGDSEDLRIANILFNNLDIIANQETIVELIGFTQR 49          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|930658000|gb|KPJ00215.1| (Vacuolar protein sorting-associated protein 13D [Papilio xuthus])

HSP 1 Score: 106.301 bits (264), Expect = 3.814e-24
Identity = 47/57 (82.46%), Postives = 53/57 (92.98%), Query Frame = 0
Query:   71 WAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            W+APG+VD+EALIAVE+C VKG+ DSEDL IANILFNNLD+IANQETIVELIGFA R
Sbjct:  713 WSAPGLVDTEALIAVEICLVKGDSDSEDLRIANILFNNLDVIANQETIVELIGFAHR 769          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|910315412|ref|XP_013181972.1| (PREDICTED: vacuolar protein sorting-associated protein 13D [Papilio xuthus])

HSP 1 Score: 105.916 bits (263), Expect = 4.863e-24
Identity = 47/57 (82.46%), Postives = 53/57 (92.98%), Query Frame = 0
Query:   71 WAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            W+APG+VD+EALIAVE+C VKG+ DSEDL IANILFNNLD+IANQETIVELIGFA R
Sbjct: 1077 WSAPGLVDTEALIAVEICLVKGDSDSEDLRIANILFNNLDVIANQETIVELIGFAHR 1133          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|943959170|ref|XP_014362235.1| (PREDICTED: vacuolar protein sorting-associated protein 13D-like [Papilio machaon])

HSP 1 Score: 104.76 bits (260), Expect = 1.135e-23
Identity = 51/64 (79.69%), Postives = 57/64 (89.06%), Query Frame = 0
Query:   64 WGSSGPGWAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            WG  G GW+APG+VD+EALIAVE+C VKG+ DSEDL IANILFNNLD+IANQETIVELIGFA R
Sbjct: 1086 WGG-GNGWSAPGLVDTEALIAVEICLVKGDADSEDLRIANILFNNLDVIANQETIVELIGFAHR 1148          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|768429459|ref|XP_011555910.1| (PREDICTED: vacuolar protein sorting-associated protein 13D-like [Plutella xylostella])

HSP 1 Score: 87.0409 bits (214), Expect = 2.231e-17
Identity = 58/102 (56.86%), Postives = 61/102 (59.80%), Query Frame = 0
Query:   36 AADPTATSGPAAPAWGAAPTGRGSTGPGWGSSGP----------GWAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            A  PTA   PA P WGA              +            GW A G+VD EALIA+ELCFVKG   SEDL IANILFNNLDIIANQETIVELIGF QR
Sbjct: 1041 AKSPTAWGAPAGP-WGAVQGWGPGGTGWGPGASTLGAGGGWAGAGWGAAGMVDEEALIAIELCFVKGGEGSEDLRIANILFNNLDIIANQETIVELIGFTQR 1141          
BLAST of HiSeq13006 vs. genbank:protein
Match: gi|1108464609|emb|CRL07319.1| (CLUMA_CG020298, isoform A [Clunio marinus])

HSP 1 Score: 75.8702 bits (185), Expect = 1.510e-13
Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 0
Query:   66 SSGPGWAAPGIVDSEALIAVELCFVKGEGDSEDLHIANILFNNLDIIANQETIVELIGFAQR 127
            +S P W AP + D +ALI +E+  ++ E   + LHIANI FNNL IIANQETIVELIGFA+R
Sbjct: 1063 ASPPHWNAP-LDDVDALITIEIVLIEAENGGDRLHIANIQFNNLGIIANQETIVELIGFAKR 1123          
The following BLAST results are available for this feature:
BLAST of HiSeq13006 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913328866|ref|XP_013195966.1|1.174e-2867.02PREDICTED: vacuolar protein sorting-associated pro... [more]
gi|357625327|gb|EHJ75807.1|1.513e-2853.13hypothetical protein KGM_07583 [Danaus plexippus][more]
gi|914573558|gb|KOB76063.1|2.565e-2856.52Uncharacterized protein OBRU01_06385 [Operophtera ... [more]
gi|930671500|gb|KPJ12217.1|3.070e-2579.69Vacuolar protein sorting-associated protein 13D [P... [more]
gi|1073543049|gb|JAT88636.1|2.301e-2493.88hypothetical protein g.18979, partial [Pectinophor... [more]
gi|930658000|gb|KPJ00215.1|3.814e-2482.46Vacuolar protein sorting-associated protein 13D [P... [more]
gi|910315412|ref|XP_013181972.1|4.863e-2482.46PREDICTED: vacuolar protein sorting-associated pro... [more]
gi|943959170|ref|XP_014362235.1|1.135e-2379.69PREDICTED: vacuolar protein sorting-associated pro... [more]
gi|768429459|ref|XP_011555910.1|2.231e-1756.86PREDICTED: vacuolar protein sorting-associated pro... [more]
gi|1108464609|emb|CRL07319.1|1.510e-1359.68CLUMA_CG020298, isoform A [Clunio marinus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0045053 protein retention in Golgi apparatus
biological_process GO:0006623 protein targeting to vacuole
cellular_component GO:0019898 extrinsic component of membrane
cellular_component GO:0005622 intracellular
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13006HiSeq13006Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13006_p ID=HiSeq13006_p|Name=HiSeq13006|organism=Ostrinia scapulalis|type=polypeptide|length=128bp
MAGTTAYPYPDIERTSPLPNWSSGSTWSIGSPPGSAADPTATSGPAAPAW
GAAPTGRGSTGPGWGSSGPGWAAPGIVDSEALIAVELCFVKGEGDSEDLH
IANILFNNLDIIANQETIVELIGFAQRX
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0019898extrinsic component of membrane
GO:0005622intracellular
Vocabulary: Biological Process
TermDefinition
GO:0045053protein retention in Golgi apparatus
GO:0006623protein targeting to vacuole