HiSeq13007_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13007
Unique NameHiSeq13007_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length172
Homology
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|943973584|ref|XP_014368162.1| (PREDICTED: transcription factor E2F4-like [Papilio machaon])

HSP 1 Score: 247.669 bits (631), Expect = 1.610e-80
Identity = 119/163 (73.01%), Postives = 136/163 (83.44%), Query Frame = 0
Query:    1 MTDIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGK 163
            M D+YKR EKSLGLLT RFVSLLQKAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKG GPD  ++ I ++VTLLR+QIGRLEEHE L+DK LH+IEQS+KNV DD DN    YV  ++VK+CF+DSQVLV+E P G  LA ++   K
Sbjct:    1 MADVYKRNEKSLGLLTTRFVSLLQKAKDGVLDLKIATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGVGPDCTSNEIGDRVTLLRRQIGRLEEHEVLIDKHLHYIEQSLKNVLDDTDNHTLSYVTEDDVKNCFKDSQVLVLEVPLGASLAVTSPSSK 163          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|909580307|ref|XP_013146090.1| (PREDICTED: transcription factor E2F4 [Papilio polytes])

HSP 1 Score: 246.899 bits (629), Expect = 4.497e-80
Identity = 118/163 (72.39%), Postives = 136/163 (83.44%), Query Frame = 0
Query:    1 MTDIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGK 163
            M D+YKR EKSLGLLT RFVSLLQKAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKG GPD  ++ I ++VTLLR+QIGRLEEHE L+DK LH+IEQS+KNV DD DN    YV  ++VK CF+D+QVLV+E P G +LA ++   K
Sbjct:    1 MADVYKRNEKSLGLLTTRFVSLLQKAKDGVLDLKIATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGVGPDCTSNEIGDRVTLLRRQIGRLEEHEVLIDKHLHYIEQSLKNVLDDTDNHTLSYVTEDDVKKCFKDTQVLVLEVPLGANLAVTSPSAK 163          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|509181339|gb|JAA88790.1| (E2F transcription factor 4-like protein [Pararge aegeria])

HSP 1 Score: 244.588 bits (623), Expect = 3.283e-79
Identity = 122/177 (68.93%), Postives = 139/177 (78.53%), Query Frame = 0
Query:    1 MTDIY--KRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASAL----PGKALVSFIEI 171
            MT++Y  KRYEKSLGLLT RFVSLLQKAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKGA PD N + I  +V  LRK+I  L+EHEQLLDKQ+HWIEQSIKNV D+ DN+   YV   ++K+CFED Q+ V+EAP G DLA   L    PGK    F+ +
Sbjct:    1 MTELYSYKRYEKSLGLLTTRFVSLLQKAKDGVLDLKVATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGASPDCNTTEIGTRVIRLRKEINMLDEHEQLLDKQMHWIEQSIKNVIDNTDNETLTYVTENDIKECFEDDQIFVLEAPLGADLAVGHLSSKEPGKDHKYFLHV 177          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|910316027|ref|XP_013182302.1| (PREDICTED: transcription factor E2F4 [Papilio xuthus] >gi|930659687|gb|KPJ01732.1| Transcription factor E2F4 [Papilio xuthus])

HSP 1 Score: 244.202 bits (622), Expect = 5.090e-79
Identity = 117/163 (71.78%), Postives = 135/163 (82.82%), Query Frame = 0
Query:    1 MTDIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGK 163
            M D+YKR EKSLGLLT RFVSLLQKAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKG GPD  ++ I ++VTLLR+QIGRLEEHE ++DK LH+IEQS+KNV DD DN    YV  ++VK+CF+D QVLV+E P G  LA ++   K
Sbjct:    1 MADVYKRNEKSLGLLTTRFVSLLQKAKDGVLDLKIATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGVGPDCTSNEIGDRVTLLRRQIGRLEEHEVVIDKHLHYIEQSLKNVLDDTDNHTLSYVTEDDVKNCFKDGQVLVLEVPLGASLAVNSPTSK 163          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|357612247|gb|EHJ67877.1| (E2F transcription factor 4-like protein [Danaus plexippus])

HSP 1 Score: 236.884 bits (603), Expect = 3.350e-76
Identity = 125/156 (80.13%), Postives = 135/156 (86.54%), Query Frame = 0
Query:    5 YKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASAL 160
            YKRYEKSLGLLT RFVSLL+KAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKGA PDGN S I +KVTLLRKQIG LEEHE+LLDKQ+HWIEQSIKNV DD DN A  YV   +VK+CF DSQVLV+EAP G +L+   L
Sbjct:    7 YKRYEKSLGLLTTRFVSLLKKAKDGVLDLKIATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGASPDGNTSEIGKKVTLLRKQIGLLEEHEELLDKQMHWIEQSIKNVIDDADNDALSYVTQNDVKNCFHDSQVLVLEAPLGANLSVGQL 162          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|768439933|ref|XP_011561624.1| (PREDICTED: transcription factor E2F4 [Plutella xylostella])

HSP 1 Score: 234.187 bits (596), Expect = 4.766e-75
Identity = 113/164 (68.90%), Postives = 138/164 (84.15%), Query Frame = 0
Query:    1 MTDI-YKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGK 163
            M D+ YKRYEKSLGLLT RFVSL++KAKDGVLDLK AT++LAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKGAGPD  +S + +KVTLLRKQI  L+E E+LLD Q HWIEQSIKNV D+ +N+A+ YVN  +++ CF ++QVLV+EAP G+ L+  ++  K
Sbjct:    1 MADVCYKRYEKSLGLLTTRFVSLVKKAKDGVLDLKVATNMLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGAGPDITSSEVGKKVTLLRKQIAILDEREELLDNQRHWIEQSIKNVLDESENEARTYVNESDIRSCFTNNQVLVLEAPLGSTLSVGSVFSK 164          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|913318133|ref|XP_013190081.1| (PREDICTED: transcription factor E2F4-like [Amyelois transitella])

HSP 1 Score: 226.098 bits (575), Expect = 6.772e-72
Identity = 112/162 (69.14%), Postives = 132/162 (81.48%), Query Frame = 0
Query:    3 DIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCF-EDSQVLVIEAPFGTDLAASALPGK 163
            ++YKRYEKSLGLLT RFVSLLQKA+DG LDLK AT+LLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKGAGPD N + I  KVT LR+QIGRLEE E++LD QL WI QSIKNV +D+DN+  +YV  ++V  C   DSQVL +E   GT+++AS +  K
Sbjct:    9 NVYKRYEKSLGLLTTRFVSLLQKARDGALDLKLATNLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGAGPDCNTNDIGRKVTSLRRQIGRLEEKEKVLDNQLQWITQSIKNVLEDVDNKDLLYVKQDDVIKCLPPDSQVLALETKLGTNISASVMQRK 170          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|914574216|gb|KOB76568.1| (E2F transcription factor 4-like protein [Operophtera brumata])

HSP 1 Score: 223.787 bits (569), Expect = 3.618e-71
Identity = 112/158 (70.89%), Postives = 128/158 (81.01%), Query Frame = 0
Query:    5 YKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPG 162
            YKRYEKSLGLLT RFVSLLQKAKDGVLDLK AT+LLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPD N++ I  KV  LRKQI +++E+++LL+KQLHWIEQS+KNV DD DNQ   YV   ++++CFEDSQ+L  E      L A    G
Sbjct:    6 YKRYEKSLGLLTTRFVSLLQKAKDGVLDLKTATNLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDCNSNDIGRKVIALRKQISQIDEYDRLLNKQLHWIEQSVKNVLDDTDNQDLCYVTNMDIQECFEDSQMLDTEMNIFLHLKAEESMG 163          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|114051451|ref|NP_001040298.1| (E2F transcription factor 4-like protein [Bombyx mori] >gi|87248107|gb|ABD36106.1| E2F transcription factor 4-like protein [Bombyx mori])

HSP 1 Score: 222.631 bits (566), Expect = 1.719e-70
Identity = 110/164 (67.07%), Postives = 133/164 (81.10%), Query Frame = 0
Query:    1 MTDI-YKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGK 163
            MTD+ YKRYEKSLGLLT +FVSLLQKAKDGVLDLK AT+LLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQW+GAGPD + + I +KV  LRKQ+  L+EHE+LLD++L WI+QS KNV D+ DNQ   +V   E++ CF++  VLV+EAP G +L+    P K
Sbjct:    1 MTDLKYKRYEKSLGLLTTKFVSLLQKAKDGVLDLKIATNLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWRGAGPDYDKNEIGKKVMGLRKQLSYLDEHERLLDRRLQWIKQSTKNVLDEPDNQDMCFVMDTEIQQCFQNDLVLVLEAPLGANLSIGTQPNK 164          
BLAST of HiSeq13007 vs. genbank:protein
Match: gi|646713873|gb|KDR18049.1| (Transcription factor E2F4 [Zootermopsis nevadensis])

HSP 1 Score: 208.379 bits (529), Expect = 2.448e-63
Identity = 97/149 (65.10%), Postives = 120/149 (80.54%), Query Frame = 0
Query:    7 RYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDL 155
            R+EKSLGLLT RFVSLLQKA+DGVLDLK A D+LAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGP  N   + +++ +LRK+I RL+EHEQ LD    W++QSI N+TDD++N    Y+  E++  CF++  +L I+AP GT+L
Sbjct:   10 RFEKSLGLLTTRFVSLLQKARDGVLDLKVAADILAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPGCNTQEMADRLAVLRKEISRLDEHEQKLDMHKQWMQQSICNITDDVENCHLAYITHEDICRCFKEDTMLAIQAPSGTEL 158          
The following BLAST results are available for this feature:
BLAST of HiSeq13007 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943973584|ref|XP_014368162.1|1.610e-8073.01PREDICTED: transcription factor E2F4-like [Papilio... [more]
gi|909580307|ref|XP_013146090.1|4.497e-8072.39PREDICTED: transcription factor E2F4 [Papilio poly... [more]
gi|509181339|gb|JAA88790.1|3.283e-7968.93E2F transcription factor 4-like protein [Pararge a... [more]
gi|910316027|ref|XP_013182302.1|5.090e-7971.78PREDICTED: transcription factor E2F4 [Papilio xuth... [more]
gi|357612247|gb|EHJ67877.1|3.350e-7680.13E2F transcription factor 4-like protein [Danaus pl... [more]
gi|768439933|ref|XP_011561624.1|4.766e-7568.90PREDICTED: transcription factor E2F4 [Plutella xyl... [more]
gi|913318133|ref|XP_013190081.1|6.772e-7269.14PREDICTED: transcription factor E2F4-like [Amyeloi... [more]
gi|914574216|gb|KOB76568.1|3.618e-7170.89E2F transcription factor 4-like protein [Operophte... [more]
gi|114051451|ref|NP_001040298.1|1.719e-7067.07E2F transcription factor 4-like protein [Bombyx mo... [more]
gi|646713873|gb|KDR18049.1|2.448e-6365.10Transcription factor E2F4 [Zootermopsis nevadensis... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0000278 mitotic cell cycle
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005634 nucleus
cellular_component GO:0005667 transcription factor complex
molecular_function GO:0003677 DNA binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011991Winged helix-turn-helix DNA-binding domainGENE3D1.10.10.10coord: 5..74
e-value: 1.5E-28
score: 97.9
IPR003316E2F/DP family, winged-helix DNA-binding domainPFAMPF02319E2F_TDPcoord: 7..73
e-value: 4.0E-24
score: 83.8
IPR015633E2F FamilyPANTHERPTHR12081TRANSCRIPTION FACTOR E2Fcoord: 7..158
NoneNo IPR availablePANTHERPTHR12081:SF37TRANSCRIPTION FACTOR E2F2coord: 7..158
NoneNo IPR availableSUPERFAMILY46785"Winged helix" DNA-binding domaincoord: 7..71
NoneNo IPR availableSUPERFAMILY144074E2F-DP heterodimerization regioncoord: 85..159

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13007HiSeq13007Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13007_p ID=HiSeq13007_p|Name=HiSeq13007|organism=Ostrinia scapulalis|type=polypeptide|length=172bp
MTDIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYD
ITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEH
EQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAP
FGTDLAASALPGKALVSFIEIT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0000278mitotic cell cycle
GO:0006355regulation of transcription, DNA-templated
Vocabulary: INTERPRO
TermDefinition
IPR015633E2F
IPR003316E2F_WHTH_DNA-bd_dom
IPR011991WHTH_DNA-bd_dom