HiSeq13008_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13008
Unique NameHiSeq13008_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length249
Homology
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|509181339|gb|JAA88790.1| (E2F transcription factor 4-like protein [Pararge aegeria])

HSP 1 Score: 347.436 bits (890), Expect = 1.836e-118
Identity = 173/253 (68.38%), Postives = 200/253 (79.05%), Query Frame = 0
Query:    1 MTDIY--KRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAKTI-DEDMDSEVERLSE-SRVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC 249
            MT++Y  KRYEKSLGLLT RFVSLLQKAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKGA PD N + I  +V  LRK+I  L+EHEQLLDKQ+HWIEQSIKNV D+ DN+   YV   ++K+CFED Q+ V+EAP G DLA   L  K  G D +Y LH+K++NP+GVILLCD E    I DEDMD EV+  ++ +  +++  NYLLRLSPP TK DFSFSLR SEGLCDLFDIPC
Sbjct:    1 MTELYSYKRYEKSLGLLTTRFVSLLQKAKDGVLDLKVATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGASPDCNTTEIGTRVIRLRKEINMLDEHEQLLDKQMHWIEQSIKNVIDNTDNETLTYVTENDIKECFEDDQIFVLEAPLGADLAVGHLSSKEPGKDHKYFLHVKSSNPVGVILLCDVEKEPVIEDEDMDEEVQSYTDGAESILKCPNYLLRLSPPVTKQDFSFSLRGSEGLCDLFDIPC 253          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|943973584|ref|XP_014368162.1| (PREDICTED: transcription factor E2F4-like [Papilio machaon])

HSP 1 Score: 336.265 bits (861), Expect = 4.117e-114
Identity = 168/250 (67.20%), Postives = 195/250 (78.00%), Query Frame = 0
Query:    1 MTDIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAK-TIDEDMDSEVERLSESRVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC 249
            M D+YKR EKSLGLLT RFVSLLQKAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKG GPD  ++ I ++VTLLR+QIGRLEEHE L+DK LH+IEQS+KNV DD DN    YV  ++VK+CF+DSQVLV+E P G  LA ++   K    D  Y LH+K+   IGVILLCD E  K  ++E++D EV+  + S     + NYLLRLSPP TK DF+FSLR SEGLCDLFDIPC
Sbjct:    1 MADVYKRNEKSLGLLTTRFVSLLQKAKDGVLDLKIATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGVGPDCTSNEIGDRVTLLRRQIGRLEEHEVLIDKHLHYIEQSLKNVLDDTDNHTLSYVTEDDVKNCFKDSQVLVLEVPLGASLAVTSPSSK--DKDSNYSLHVKSTEQIGVILLCDAEKEKANMEENLDDEVQSYTNSCGDYHHSNYLLRLSPPITKHDFAFSLRGSEGLCDLFDIPC 248          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|910316027|ref|XP_013182302.1| (PREDICTED: transcription factor E2F4 [Papilio xuthus] >gi|930659687|gb|KPJ01732.1| Transcription factor E2F4 [Papilio xuthus])

HSP 1 Score: 326.635 bits (836), Expect = 2.953e-110
Identity = 164/251 (65.34%), Postives = 194/251 (77.29%), Query Frame = 0
Query:    1 MTDIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAK-TIDEDMDSEVERLSESRV-MMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC 249
            M D+YKR EKSLGLLT RFVSLLQKAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKG GPD  ++ I ++VTLLR+QIGRLEEHE ++DK LH+IEQS+KNV DD DN    YV  ++VK+CF+D QVLV+E P G  LA ++   K    D  Y LH+K+   IGVILLCD E  K  ++E+++ EV+  + +      + NYLLRLSPP TK DF+FSLR SEGLCDLFDIPC
Sbjct:    1 MADVYKRNEKSLGLLTTRFVSLLQKAKDGVLDLKIATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGVGPDCTSNEIGDRVTLLRRQIGRLEEHEVVIDKHLHYIEQSLKNVLDDTDNHTLSYVTEDDVKNCFKDGQVLVLEVPLGASLAVNSPTSK--DKDSNYSLHVKSTEQIGVILLCDAEKEKVNMEENLNDEVQSYTNNCGDSYHHSNYLLRLSPPITKQDFAFSLRGSEGLCDLFDIPC 249          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|357612247|gb|EHJ67877.1| (E2F transcription factor 4-like protein [Danaus plexippus])

HSP 1 Score: 325.094 bits (832), Expect = 1.178e-109
Identity = 175/245 (71.43%), Postives = 194/245 (79.18%), Query Frame = 0
Query:    5 YKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAKTIDED-MDSEVERLSESRVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIP 248
            YKRYEKSLGLLT RFVSLL+KAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKGA PDGN S I +KVTLLRKQIG LEEHE+LLDKQ+HWIEQSIKNV DD DN A  YV   +VK+CF DSQVLV+EAP G +L+   L   A   + QY LH+K+  P+GVILLCD E  K +D+D MD EVE   +S     +  YLLRLSPP TK DFSFSL  +EGLCDLFDIP
Sbjct:    7 YKRYEKSLGLLTTRFVSLLKKAKDGVLDLKIATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGASPDGNTSEIGKKVTLLRKQIGLLEEHEELLDKQMHWIEQSIKNVIDDADNDALSYVTQNDVKNCFHDSQVLVLEAPLGANLSVGQLDEGA--GEDQYFLHLKSNEPVGVILLCDVEKDKIVDDDTMDEEVEWYGDSGT-TNSQEYLLRLSPPVTKQDFSFSLYGTEGLCDLFDIP 248          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|909580307|ref|XP_013146090.1| (PREDICTED: transcription factor E2F4 [Papilio polytes])

HSP 1 Score: 320.472 bits (820), Expect = 7.831e-108
Identity = 163/251 (64.94%), Postives = 192/251 (76.49%), Query Frame = 0
Query:    1 MTDIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAK-TIDEDMDSEVERLSES-RVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC 249
            M D+YKR EKSLGLLT RFVSLLQKAKDGVLDLK ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKG GPD  ++ I ++VTLLR+QIGRLEEHE L+DK LH+IEQS+KNV DD DN    YV  ++VK CF+D+QVLV+E P G +LA ++   K       Y LH+K+   IGVI + D E  K  ++E++D EV+  + S      + NYLLRLSPP TK DF+FSLR SEGLCDLFDIPC
Sbjct:    1 MADVYKRNEKSLGLLTTRFVSLLQKAKDGVLDLKIATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGVGPDCTSNEIGDRVTLLRRQIGRLEEHEVLIDKHLHYIEQSLKNVLDDTDNHTLSYVTEDDVKKCFKDTQVLVLEVPLGANLAVTSPSAK--DKLSSYSLHVKSTEQIGVIHVSDMEKEKANMEENIDDEVQSYTNSCDDAYHHSNYLLRLSPPITKQDFAFSLRGSEGLCDLFDIPC 249          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|768439933|ref|XP_011561624.1| (PREDICTED: transcription factor E2F4 [Plutella xylostella])

HSP 1 Score: 314.309 bits (804), Expect = 2.347e-105
Identity = 160/251 (63.75%), Postives = 200/251 (79.68%), Query Frame = 0
Query:    1 MTDI-YKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAKTI-DEDM-DSEVERLSESRVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIP 248
            M D+ YKRYEKSLGLLT RFVSL++KAKDGVLDLK AT++LAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKGAGPD  +S + +KVTLLRKQI  L+E E+LLD Q HWIEQSIKNV D+ +N+A+ YVN  +++ CF ++QVLV+EAP G+ L+  ++  K    + Q++LH+++AN +GVILLCD+E  K   DE M D EVE + +    ++  +YLLRLSPP TK+DFSFSL  +EGLCDLFDIP
Sbjct:    1 MADVCYKRYEKSLGLLTTRFVSLVKKAKDGVLDLKVATNMLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGAGPDITSSEVGKKVTLLRKQIAILDEREELLDNQRHWIEQSIKNVLDESENEARTYVNESDIRSCFTNNQVLVLEAPLGSTLSVGSVFSKE-KREEQFILHVESANSVGVILLCDREKEKQARDEAMDDEEVESIMDDCEEIKCPDYLLRLSPPITKNDFSFSLCGNEGLCDLFDIP 250          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|913318133|ref|XP_013190081.1| (PREDICTED: transcription factor E2F4-like [Amyelois transitella])

HSP 1 Score: 308.145 bits (788), Expect = 5.234e-103
Identity = 154/248 (62.10%), Postives = 196/248 (79.03%), Query Frame = 0
Query:    3 DIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCF-EDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAKTIDEDMDSEVERLSESRVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC 249
            ++YKRYEKSLGLLT RFVSLLQKA+DG LDLK AT+LLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKGAGPD N + I  KVT LR+QIGRLEE E++LD QL WI QSIKNV +D+DN+  +YV  ++V  C   DSQVL +E   GT+++AS +  K    DP ++LH++++ P+ VILLCD+E  + ++E+ D E++  +E+    + ++YLLRLSPP TK+D++FSL  SEGLCDLFDIPC
Sbjct:    9 NVYKRYEKSLGLLTTRFVSLLQKARDGALDLKLATNLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGAGPDCNTNDIGRKVTSLRRQIGRLEEKEKVLDNQLQWITQSIKNVLEDVDNKDLLYVKQDDVIKCLPPDSQVLALETKLGTNISASVMQRK--DKDPHFILHVQSSEPVNVILLCDREKEEAMEEENDKEIQSYTENGECTKYNDYLLRLSPPLTKNDYAFSLCGSEGLCDLFDIPC 254          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|914574216|gb|KOB76568.1| (E2F transcription factor 4-like protein [Operophtera brumata])

HSP 1 Score: 286.96 bits (733), Expect = 6.988e-95
Identity = 152/252 (60.32%), Postives = 183/252 (72.62%), Query Frame = 0
Query:    5 YKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDK--EDAKTIDEDMDSEVERLSESRV-----MMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC 249
            YKRYEKSLGLLT RFVSLLQKAKDGVLDLK AT+LLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPD N++ I  KV  LRKQI +++E+++LL+KQLHWIEQS+KNV DD DNQ   YV   ++++CFEDSQ+L  E                        LH+KA   +GVI L +K  +DA + ++ MD EVE L++ ++      +  +N +LRLSPP  K DF+FSLR SEGLCDLFDIPC
Sbjct:    6 YKRYEKSLGLLTTRFVSLLQKAKDGVLDLKTATNLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDCNSNDIGRKVIALRKQISQIDEYDRLLNKQLHWIEQSVKNVLDDTDNQDLCYVTNMDIQECFEDSQMLDTEMNI--------------------FLHLKAEESMGVIHLSEKIEQDADSDEDSMDGEVEGLTKFKIPTCDNTLRANNCVLRLSPPLRKCDFTFSLRGSEGLCDLFDIPC 237          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|114051451|ref|NP_001040298.1| (E2F transcription factor 4-like protein [Bombyx mori] >gi|87248107|gb|ABD36106.1| E2F transcription factor 4-like protein [Bombyx mori])

HSP 1 Score: 278.87 bits (712), Expect = 2.755e-91
Identity = 147/260 (56.54%), Postives = 189/260 (72.69%), Query Frame = 0
Query:    1 MTDI-YKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDK----------EDAKTIDEDMDSEVERLSESRVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC 249
            MTD+ YKRYEKSLGLLT +FVSLLQKAKDGVLDLK AT+LLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQW+GAGPD + + I +KV  LRKQ+  L+EHE+LLD++L WI+QS KNV D+ DNQ   +V   E++ CF++  VLV+EAP G +L+    P K    +  +LLH+K++  +GV+LL DK          E+  + +E  D+ ++    S      ++ LLRLSPP +K DF FSL ++EGLC+LFDIPC
Sbjct:    1 MTDLKYKRYEKSLGLLTTKFVSLLQKAKDGVLDLKIATNLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWRGAGPDYDKNEIGKKVMGLRKQLSYLDEHERLLDRRLQWIKQSTKNVLDEPDNQDMCFVMDTEIQQCFQNDLVLVLEAPLGANLSIGTQPNK--DRESNFLLHIKSSESMGVVLLNDKEEEEEEEYEDEETNSNNEMEDNNIKCFKNSEEASLINDCLLRLSPPASKYDFLFSLSNTEGLCELFDIPC 258          
BLAST of HiSeq13008 vs. genbank:protein
Match: gi|930666771|gb|KPJ07879.1| (Transcription factor E2F4 [Papilio machaon])

HSP 1 Score: 279.256 bits (713), Expect = 7.219e-89
Identity = 138/215 (64.19%), Postives = 164/215 (76.28%), Query Frame = 0
Query:   36 ATDLLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEHEQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAPFGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAK-TIDEDMDSEVERLSESRVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC 249
            ATDLLAVRQKRRIYDITNVLEGIGLIEK+SKNSIQWKG GPD  ++ I ++VTLLR+QIGRLEEHE L+DK LH+IEQS+KNV DD DN    YV  ++VK+CF+DSQVLV+E P G  LA ++   K    D  Y LH+K+   IGVILLCD E  K  ++E++D EV+  + S     + NYLLRLSPP TK DF+FSLR SEGLCDLFDIPC
Sbjct:  234 ATDLLAVRQKRRIYDITNVLEGIGLIEKRSKNSIQWKGVGPDCTSNEIGDRVTLLRRQIGRLEEHEVLIDKHLHYIEQSLKNVLDDTDNHTLSYVTEDDVKNCFKDSQVLVLEVPLGASLAVTSPSSK--DKDSNYSLHVKSTEQIGVILLCDAEKEKANMEENLDDEVQSYTNSCGDYHHSNYLLRLSPPITKHDFAFSLRGSEGLCDLFDIPC 446          
The following BLAST results are available for this feature:
BLAST of HiSeq13008 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|509181339|gb|JAA88790.1|1.836e-11868.38E2F transcription factor 4-like protein [Pararge a... [more]
gi|943973584|ref|XP_014368162.1|4.117e-11467.20PREDICTED: transcription factor E2F4-like [Papilio... [more]
gi|910316027|ref|XP_013182302.1|2.953e-11065.34PREDICTED: transcription factor E2F4 [Papilio xuth... [more]
gi|357612247|gb|EHJ67877.1|1.178e-10971.43E2F transcription factor 4-like protein [Danaus pl... [more]
gi|909580307|ref|XP_013146090.1|7.831e-10864.94PREDICTED: transcription factor E2F4 [Papilio poly... [more]
gi|768439933|ref|XP_011561624.1|2.347e-10563.75PREDICTED: transcription factor E2F4 [Plutella xyl... [more]
gi|913318133|ref|XP_013190081.1|5.234e-10362.10PREDICTED: transcription factor E2F4-like [Amyeloi... [more]
gi|914574216|gb|KOB76568.1|6.988e-9560.32E2F transcription factor 4-like protein [Operophte... [more]
gi|114051451|ref|NP_001040298.1|2.755e-9156.54E2F transcription factor 4-like protein [Bombyx mo... [more]
gi|930666771|gb|KPJ07879.1|7.219e-8964.19Transcription factor E2F4 [Papilio machaon][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005634 nucleus
cellular_component GO:0005667 transcription factor complex
molecular_function GO:0003677 DNA binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003316E2F/DP family, winged-helix DNA-binding domainPFAMPF02319E2F_TDPcoord: 7..73
e-value: 8.6E-24
score: 82.7
IPR011991Winged helix-turn-helix DNA-binding domainGENE3D1.10.10.10coord: 5..74
e-value: 3.3E-28
score: 96.8
NoneNo IPR availablePANTHERPTHR12081:SF37TRANSCRIPTION FACTOR E2F2coord: 7..249
NoneNo IPR availableSUPERFAMILY144074E2F-DP heterodimerization regioncoord: 85..189
NoneNo IPR availableSUPERFAMILY46785"Winged helix" DNA-binding domaincoord: 7..71
IPR015633E2F FamilyPANTHERPTHR12081TRANSCRIPTION FACTOR E2Fcoord: 7..249

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13008HiSeq13008Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13008_p ID=HiSeq13008_p|Name=HiSeq13008|organism=Ostrinia scapulalis|type=polypeptide|length=249bp
MTDIYKRYEKSLGLLTIRFVSLLQKAKDGVLDLKFATDLLAVRQKRRIYD
ITNVLEGIGLIEKKSKNSIQWKGAGPDGNASSITEKVTLLRKQIGRLEEH
EQLLDKQLHWIEQSIKNVTDDIDNQAKMYVNPEEVKDCFEDSQVLVIEAP
FGTDLAASALPGKALGADPQYLLHMKAANPIGVILLCDKEDAKTIDEDMD
SEVERLSESRVMMENDNYLLRLSPPPTKSDFSFSLRDSEGLCDLFDIPC
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: INTERPRO
TermDefinition
IPR015633E2F
IPR011991WHTH_DNA-bd_dom
IPR003316E2F_WHTH_DNA-bd_dom