HiSeq13028_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13028
Unique NameHiSeq13028_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length515
Homology
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|913304311|ref|XP_013201116.1| (PREDICTED: heat shock protein 68-like [Amyelois transitella])

HSP 1 Score: 1036.56 bits (2679), Expect = 0.000e+0
Identity = 498/515 (96.70%), Postives = 511/515 (99.22%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRK+DDPKIQQDM+HWPFKVI+DCGKPKIQVEFKGE KRFAPEEISSMVLTKMKETAEAYLGT+VRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHL +EFKRKYKKD+ +NPRALRRLRTAAERAKRTLSSSTEA+IEIDAL+EGID+YTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSML NFFCGKKLNLSINPDEAVAYGAAVQAAILSGE+HSKIQDVLLVDVAPLSLGIETAGGVMTKI+ERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKYDDPKIQQDMQHWPFKVINDCGKPKIQVEFKGETKRFAPEEISSMVLTKMKETAEAYLGTTVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDMKSNPRALRRLRTAAERAKRTLSSSTEATIEIDALHEGIDFYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLQNFFCGKKLNLSINPDEAVAYGAAVQAAILSGERHSKIQDVLLVDVAPLSLGIETAGGVMTKIVERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|379698914|ref|NP_001243928.1| (heat shock protein 68 [Bombyx mori] >gi|336454476|gb|AEI58997.1| heat shock protein 68 [Bombyx mori])

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 495/515 (96.12%), Postives = 509/515 (98.83%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDD KIQQD+KHWPFKVISDCGKPKIQ+EFKGE KRFAPEEISSMVL KM+ETAEAYLGT++RDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHL EEFKRKYK+DI++NPRALRRLRTAAERAKRTLSSSTEA+IEIDALYEGID+YTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSML NFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSD+QPAVTIQVYEGERAMTKDNN+LGRFDLTGIPPAPRGVPKIDVTFD+DANGILNVSAKEN TGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDAKIQQDLKHWPFKVISDCGKPKIQIEFKGETKRFAPEEISSMVLIKMRETAEAYLGTAIRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLAEEFKRKYKRDITSNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLQNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDSQPAVTIQVYEGERAMTKDNNMLGRFDLTGIPPAPRGVPKIDVTFDIDANGILNVSAKENGTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|526299274|gb|AGR84216.1| (heat shock protein 70-1 [Melitaea cinxia])

HSP 1 Score: 1030.01 bits (2662), Expect = 0.000e+0
Identity = 495/515 (96.12%), Postives = 507/515 (98.45%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP+NTVFDAKRLIGRKFDDPKIQQDMKHWPFKV+SDCGKPKIQVEFKGE KRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHL +EFKRKYKKD+ +NPRALRRLRTAAERAKRTLSSSTEA+IEIDALYEGID+YTRVSRARFEELN+DLFRGTLEPVEKALKDAK+DKS IHDVVLVGGSTRIPK+QSML NFFCGKKLNLSINPDEAVAYGAAVQAAILSGE HSKIQDVLLVDVAPLSLGIETAGGVMTKIIERN KIPCKQSQTFTTY+DNQPAVTIQVYEGERAMTKDNNLLG FDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVVSDCGKPKIQVEFKGEMKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELNSDLFRGTLEPVEKALKDAKMDKSQIHDVVLVGGSTRIPKVQSMLQNFFCGKKLNLSINPDEAVAYGAAVQAAILSGESHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNCKIPCKQSQTFTTYADNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|943456515|gb|ALL42052.1| (heat shock protein 70-2 [Antheraea pernyi])

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 496/515 (96.31%), Postives = 508/515 (98.64%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP+NTVFDAKRLIGRK+DDPKIQQDM+HWPFKVI+DC KPKIQVEFKGE K+FAPEEISSMVLTKMKETAEAYLGT+VRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNR+V HL EEFKRKYKKDI +NPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTR+SRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSML  FFCGK+LNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRKYDDPKIQQDMQHWPFKVINDCSKPKIQVEFKGEIKKFAPEEISSMVLTKMKETAEAYLGTTVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRVVTHLAEEFKRKYKKDIRSNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRLSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLQGFFCGKQLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|526299382|gb|AGR84224.1| (heat shock protein 70-2 [Melitaea cinxia])

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 494/515 (95.92%), Postives = 508/515 (98.64%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP+NTVFDAKRLIGRKFDDPKIQQDM+HWPFKV++DCGKPKIQVEFKGE KRFAPEEISSMVL KMKETAEAYLGT+VRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHL EEFKRKYKKD+  N RALRRLRTAAERAKRTLSSSTEA+IEIDALY+GID+YTRVSRARFEELN+DLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQ+ML NFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPC+QSQTFTTYSDNQPAVT+QVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRKFDDPKIQQDMQHWPFKVVNDCGKPKIQVEFKGETKRFAPEEISSMVLVKMKETAEAYLGTAVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRGNARALRRLRTAAERAKRTLSSSTEATIEIDALYDGIDFYTRVSRARFEELNSDLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQNMLQNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCRQSQTFTTYSDNQPAVTVQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|526299286|gb|AGR84217.1| (heat shock protein 70-1 [Melitaea cinxia])

HSP 1 Score: 1028.08 bits (2657), Expect = 0.000e+0
Identity = 495/515 (96.12%), Postives = 507/515 (98.45%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP+NTVFDAKRLIGRKFDDPKIQQDMKHWPFKV+SDCGKPKIQVEFKGE KRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHL +EFKRKYKKD+ +NPRALRRLRTAAERAKRTLSSSTEA+IEIDALYEGID+YTRVSRARFEELN+DLFRGTLEPVEKALKDAK+DKS IHDVVLVGGSTRIPK+QSML NFFCGKKLNLSINPDEAVAYGAAVQAAILSGE HSKIQDVLLVDVAPLSLGIETAGGVMTKIIERN KIPCKQSQTFTTY+DNQPAVTIQVYEGERAMTKDNNLLG FDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVVSDCGKPKIQVEFKGEMKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELNSDLFRGTLEPVEKALKDAKMDKSQIHDVVLVGGSTRIPKVQSMLQNFFCGKKLNLSINPDEAVAYGAAVQAAILSGESHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNCKIPCKQSQTFTTYADNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|526299367|gb|AGR84223.1| (heat shock protein 70-2 [Melitaea cinxia])

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 493/515 (95.73%), Postives = 507/515 (98.45%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP+NTVFDAKRLIGRKF DPKIQQDM+HWPFKV++DCGKPKIQVEFKGE KRFAPEEISSMVL KMKETAEAYLGT+VRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHL EEFKRKYKKD+  N RALRRLRTAAERAKRTLSSSTEA+IEIDALY+GID+YTRVSRARFEELN+DLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQ+ML NFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPC+QSQTFTTYSDNQPAVT+QVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRKFGDPKIQQDMQHWPFKVVNDCGKPKIQVEFKGETKRFAPEEISSMVLVKMKETAEAYLGTAVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRGNARALRRLRTAAERAKRTLSSSTEATIEIDALYDGIDFYTRVSRARFEELNSDLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQNMLQNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCRQSQTFTTYSDNQPAVTVQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|310893431|gb|ADP37711.1| (heat shock protein 70 [Helicoverpa armigera])

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 493/515 (95.73%), Postives = 507/515 (98.45%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVALNP+NTVFDAKRLIGRKFDDPKIQQDM+HWPFKVI+DCGKPKIQVEFKGE KRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV++TAGDTHLGGEDFDNRLVN L +EFKRK+KKDI  N RALRRLRTAAERAKRTLSSSTEASIEIDAL+EGID+YTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQ+ML NFFCGKKL LSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKI+ERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERA+TKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVALNPNNTVFDAKRLIGRKFDDPKIQQDMQHWPFKVINDCGKPKIQVEFKGETKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNFLADEFKRKFKKDIKNNSRALRRLRTAAERAKRTLSSSTEASIEIDALHEGIDFYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQNMLQNFFCGKKLTLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIVERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAVTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|256862212|gb|ACV32640.1| (heat shock protein 70 [Helicoverpa zea])

HSP 1 Score: 1023.46 bits (2645), Expect = 0.000e+0
Identity = 492/515 (95.53%), Postives = 508/515 (98.64%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPS+VAFTD+ERLIGDAAK+QVALNP+NTVFDAKRLIGRKFDDPKIQQDM+HWPFKVI+DCGKPKIQVEFKGE KRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLN+LRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV++TAGDTHLGGEDFDNRLVN L +EFKRK+KKDI  N RALRRLRTAAERAKRTLSSSTEASIEIDAL+EGID+YTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQ+ML NFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKI+ERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSFVAFTDSERLIGDAAKDQVALNPNNTVFDAKRLIGRKFDDPKIQQDMQHWPFKVINDCGKPKIQVEFKGETKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNILRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRSTAGDTHLGGEDFDNRLVNFLADEFKRKFKKDIKNNSRALRRLRTAAERAKRTLSSSTEASIEIDALHEGIDFYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQNMLQNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIVERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
BLAST of HiSeq13028 vs. genbank:protein
Match: gi|113676411|ref|NP_001037396.1| (heat shock protein 70 [Bombyx mori] >gi|87248163|gb|ABD36134.1| heat shock protein 70 [Bombyx mori])

HSP 1 Score: 1021.54 bits (2640), Expect = 0.000e+0
Identity = 490/515 (95.15%), Postives = 505/515 (98.06%), Query Frame = 0
Query:    1 MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKIQVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKDISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTNFFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515
            MPA+GIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP+NTVFDAKRLIGRKFDDPKIQQDMKHWPFKVI+DCGKPKIQ+EFKGE KRFAPEEISSMVLTKMKETAEAYLG++VRDAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVK+TAGDTHLGGEDFDNRLVNHL EEFKRKYKKD+  N RALRRLRTAAERAKRTLSSSTEA+IEIDALYEGID+YTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKS IHDVVLVGGSTRIPK+Q+ML NFFCGKKLNLSINPDEAVAYGAAVQAAILSGE  SKIQDVLLVDVAPLSLGIETAGGVMTKIIERN+KIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLG FDLTGIPPAPRGVPKIDVTFD+DANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR
Sbjct:    1 MPAIGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVINDCGKPKIQIEFKGETKRFAPEEISSMVLTKMKETAEAYLGSTVRDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKSTAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRLNSRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELNADLFRGTLEPVEKALKDAKLDKSQIHDVVLVGGSTRIPKVQTMLQNFFCGKKLNLSINPDEAVAYGAAVQAAILSGETDSKIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRGVPKIDVTFDMDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDR 515          
The following BLAST results are available for this feature:
BLAST of HiSeq13028 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913304311|ref|XP_013201116.1|0.000e+096.70PREDICTED: heat shock protein 68-like [Amyelois tr... [more]
gi|379698914|ref|NP_001243928.1|0.000e+096.12heat shock protein 68 [Bombyx mori] >gi|336454476|... [more]
gi|526299274|gb|AGR84216.1|0.000e+096.12heat shock protein 70-1 [Melitaea cinxia][more]
gi|943456515|gb|ALL42052.1|0.000e+096.31heat shock protein 70-2 [Antheraea pernyi][more]
gi|526299382|gb|AGR84224.1|0.000e+095.92heat shock protein 70-2 [Melitaea cinxia][more]
gi|526299286|gb|AGR84217.1|0.000e+096.12heat shock protein 70-1 [Melitaea cinxia][more]
gi|526299367|gb|AGR84223.1|0.000e+095.73heat shock protein 70-2 [Melitaea cinxia][more]
gi|310893431|gb|ADP37711.1|0.000e+095.73heat shock protein 70 [Helicoverpa armigera][more]
gi|256862212|gb|ACV32640.1|0.000e+095.53heat shock protein 70 [Helicoverpa zea][more]
gi|113676411|ref|NP_001037396.1|0.000e+095.15heat shock protein 70 [Bombyx mori] >gi|87248163|g... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005524 ATP binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 258..279
NoneNo IPR availableGENE3D3.30.420.40coord: 2..51
e-value: 6.1E-71
score: 236.7
coord: 120..198
e-value: 6.1E-71
score: 236.7
NoneNo IPR availableGENE3D3.90.640.10coord: 229..308
e-value: 2.7E-38
score: 129.4
NoneNo IPR availableGENE3D3.30.420.40coord: 314..357
e-value: 3.7E-37
score: 125.0
coord: 199..228
e-value: 3.7E-37
score: 125.0
NoneNo IPR availableGENE3D3.30.30.30coord: 52..111
e-value: 2.2E-38
score: 129.7
NoneNo IPR availablePANTHERPTHR19375:SF142HEAT SHOCK 70 KDA PROTEIN COGNATE 1-RELATEDcoord: 1..515
NoneNo IPR availablePANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 1..515
NoneNo IPR availableSUPERFAMILY53067Actin-like ATPase domaincoord: 1..184
NoneNo IPR availableSUPERFAMILY53067Actin-like ATPase domaincoord: 187..380
IPR013126Heat shock protein 70 familyPRINTSPR00301HEATSHOCK70coord: 2..15
score: 81.55
coord: 200..210
score: 81.18
coord: 388..407
score: 79.7
coord: 30..42
score: 85.18
coord: 361..381
score: 81.15
coord: 139..159
score: 93.9
coord: 469..485
score: 71.91
coord: 329..345
score: 76.74
coord: 52..60
score: 73.06
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 3..515
e-value: 1.4E-246
score: 819.0
IPR029047Heat shock protein 70kD, peptide-binding domainGENE3D2.60.34.10coord: 367..515
e-value: 6.4E-71
score: 237.5
IPR029047Heat shock protein 70kD, peptide-binding domainSUPERFAMILY100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 385..515
IPR018181Heat shock protein 70, conserved sitePROSITEPS01036HSP70_3coord: 332..346
IPR018181Heat shock protein 70, conserved sitePROSITEPS00297HSP70_1coord: 6..13
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 194..207

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13028HiSeq13028Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13028_p ID=HiSeq13028_p|Name=HiSeq13028|organism=Ostrinia scapulalis|type=polypeptide|length=515bp
MPAVGIDLGTTYSCVGVWQHGNVEIIANDQGNRTTPSYVAFTDTERLIGD
AAKNQVALNPSNTVFDAKRLIGRKFDDPKIQQDMKHWPFKVISDCGKPKI
QVEFKGEAKRFAPEEISSMVLTKMKETAEAYLGTSVRDAVITVPAYFNDS
QRQATKDAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGG
TFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLVEEFKRKYKKD
ISTNPRALRRLRTAAERAKRTLSSSTEASIEIDALYEGIDYYTRVSRARF
EELNADLFRGTLEPVEKALKDAKLDKSSIHDVVLVGGSTRIPKIQSMLTN
FFCGKKLNLSINPDEAVAYGAAVQAAILSGEQHSKIQDVLLVDVAPLSLG
IETAGGVMTKIIERNAKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKD
NNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIV
IKNDKGRLSQAEIDR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
Vocabulary: INTERPRO
TermDefinition
IPR018181Heat_shock_70_CS
IPR029047HSP70_peptide-bd
IPR013126Hsp_70_fam