HiSeq13029_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13029
Unique NameHiSeq13029_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length189
Homology
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|317135488|gb|ADV03160.1| (heat shock protein 70 [Spodoptera litura])

HSP 1 Score: 296.204 bits (757), Expect = 3.075e-94
Identity = 142/185 (76.76%), Postives = 162/185 (87.57%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMHG-GGQAQGGMPGGAGGMPGGMPGGMGG 184
            DNNLLGTF+LTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRS+ IVIKND+GRLSQAEI+RMLA+AEKYK+ED++QR+RVA+RN+LE+YVF VKQALDEAGDKL+EQDK T R  C++ L+WLDNN LAE+EEYEH+LK+VQ VC P+M KMHG G Q    MP   GGM  GMPGG GG
Sbjct:  450 DNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIERMLAEAEKYKDEDEKQRQRVASRNQLESYVFSVKQALDEAGDKLTEQDKSTARDACDDALKWLDNNTLAEQEEYEHKLKDVQRVCSPVMAKMHGAGAQNADDMP---GGMSEGMPGGYGG 631          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|930677533|gb|KPJ17592.1| (Heat shock protein 68 [Papilio machaon])

HSP 1 Score: 280.411 bits (716), Expect = 8.622e-93
Identity = 128/158 (81.01%), Postives = 149/158 (94.30%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMH 158
            DNNLLGTF+LTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRS+ IVIKND+GRLSQA+IDRML++AE+Y+EED++QR+RVAARN+LE+YVF VKQALDEAGDKLSE+DK+T RREC++ L+WLDNN LAEREEYEHRL ++Q +C P MTKMH
Sbjct:   91 DNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQADIDRMLSEAERYREEDEKQRQRVAARNQLESYVFSVKQALDEAGDKLSEEDKNTARRECDDALKWLDNNTLAEREEYEHRLTQLQRLCSPTMTKMH 248          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|943943041|ref|XP_014355014.1| (PREDICTED: heat shock protein 68-like [Papilio machaon])

HSP 1 Score: 280.796 bits (717), Expect = 1.087e-92
Identity = 128/158 (81.01%), Postives = 149/158 (94.30%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMH 158
            DNNLLGTF+LTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRS+ IVIKND+GRLSQA+IDRML++AE+Y+EED++QR+RVAARN+LE+YVF VKQALDEAGDKLSE+DK+T RREC++ L+WLDNN LAEREEYEHRL ++Q +C P MTKMH
Sbjct:  100 DNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQADIDRMLSEAERYREEDEKQRQRVAARNQLESYVFSVKQALDEAGDKLSEEDKNTARRECDDALKWLDNNTLAEREEYEHRLTQLQRLCSPTMTKMH 257          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|943456515|gb|ALL42052.1| (heat shock protein 70-2 [Antheraea pernyi])

HSP 1 Score: 291.582 bits (745), Expect = 1.260e-92
Identity = 136/166 (81.93%), Postives = 151/166 (90.96%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMHGGGQAQGG 166
            DNNLLG F+LTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRS+ IVIKND+GRLSQAEIDRMLA+AE+YKEEDDRQRERVAARN LE+YVF VKQALDEAGDKLSEQDKD  RRECE+ L+WLDNN LAE++EYE+RLKE+Q +C P+M+KMHG G    G
Sbjct:  450 DNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDRMLAEAERYKEEDDRQRERVAARNNLESYVFNVKQALDEAGDKLSEQDKDAARRECEDALKWLDNNILAEKDEYEYRLKELQRICSPVMSKMHGAGTTPTG 615          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|985425888|ref|XP_015378435.1| (PREDICTED: heat shock protein 70 B2-like, partial [Diuraphis noxia])

HSP 1 Score: 285.419 bits (729), Expect = 4.944e-92
Identity = 128/177 (72.32%), Postives = 160/177 (90.40%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMHGGGQAQGGMPGGAGGMPGG 177
            DNNLLGTF+LTGIPPAPRGVPKI+VTFD+DANGILNVSAKENS+GRS+ IVIKND+GRLSQAEIDRML++AE+Y+EED+RQ+ ++AA+N+LE+YVFGVKQALDEAGDKL+E +K+TG++EC+  ++WLDNN LA++EEYE++LKE+Q  C  LM K+HG GQA GG+P GA G PG 
Sbjct:  290 DNNLLGTFDLTGIPPAPRGVPKIEVTFDMDANGILNVSAKENSSGRSKNIVIKNDKGRLSQAEIDRMLSEAEQYREEDERQKAKIAAKNQLESYVFGVKQALDEAGDKLTESEKNTGKQECDAVVQWLDNNQLADKEEYEYKLKEIQKSCSALMMKIHGAGQAAGGVPPGAHGFPGS 466          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|909554702|ref|XP_013148831.1| (PREDICTED: heat shock protein 68-like [Papilio polytes])

HSP 1 Score: 288.886 bits (738), Expect = 1.377e-91
Identity = 134/175 (76.57%), Postives = 157/175 (89.71%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMHGGGQAQGGMPGGAGGMP 175
            DNNLLGTF+LTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRS+ IVIKND+GRLSQA+IDRML++AE+Y+EED++QR+RV ARN+LE+YVF VKQA++EAGDKLSE+DK+T RRECE+ L+WLDNN LAEREEYEHRL ++Q +C P+MTKMHGG   Q G  G A G P
Sbjct:  450 DNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQADIDRMLSEAERYREEDEKQRQRVTARNQLESYVFSVKQAVEEAGDKLSEEDKNTARRECEDALKWLDNNTLAEREEYEHRLTQLQRLCSPIMTKMHGGS-TQAGPQGAAPGAP 623          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|938485353|gb|AFK93489.2| (HSP70-1 [Cydia pomonella])

HSP 1 Score: 290.041 bits (741), Expect = 1.767e-91
Identity = 134/158 (84.81%), Postives = 151/158 (95.57%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMH 158
            DNNLLGTF+LTG+PPAPRGVPKIDVTFD+DANGILNVSAKENSTGRS+ IVIKNDRGRLSQA+IDRMLA+AE+YK+ED++QR+RVAARN+LEAYVF VKQALD+AGDKLSEQDK+T R ECEETLRWLDNN+LAE EEYEH+LKEVQ VC P+MTKMH
Sbjct:  450 DNNLLGTFDLTGVPPAPRGVPKIDVTFDIDANGILNVSAKENSTGRSKNIVIKNDRGRLSQADIDRMLAEAERYKDEDEKQRKRVAARNQLEAYVFSVKQALDDAGDKLSEQDKNTARSECEETLRWLDNNSLAEVEEYEHKLKEVQRVCSPVMTKMH 607          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|1058121695|gb|JAS64496.1| (hypothetical protein g.13397, partial [Cuerna arida])

HSP 1 Score: 273.863 bits (699), Expect = 2.933e-91
Identity = 125/164 (76.22%), Postives = 149/164 (90.85%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMHGGGQAQ 164
            DNNLLGTF+LTGIPPAPRGVPKIDVTFDLDANGILNVSAK+NS+G+S+ I I+N++GRLS+ EIDRM+ +AEKYKEEDD+QRE++AARN+LE Y F VKQALDEAG+KLSE+DK T RRECEETLRWLDNN+LAE++EYEHRL+E+Q  C P+M K+HG GQ Q
Sbjct:   22 DNNLLGTFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKDNSSGKSKNITIQNNKGRLSKEEIDRMVNEAEKYKEEDDKQREKIAARNQLEGYTFNVKQALDEAGEKLSEEDKTTVRRECEETLRWLDNNSLAEKDEYEHRLRELQRQCSPIMAKLHGAGQPQ 185          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|526299367|gb|AGR84223.1| (heat shock protein 70-2 [Melitaea cinxia])

HSP 1 Score: 288.115 bits (736), Expect = 2.966e-91
Identity = 138/179 (77.09%), Postives = 157/179 (87.71%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMHG--GGQAQGGMPGGAGGMPGG 177
            DNNLLG F+LTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRS+ IVIKND+GRLSQAEIDRMLA+AE+YKEED+RQR+RV+ARN+LE+YVF VKQALDEAGDKLSEQDK+T RREC+E L+WLDNNALA++EEYEH+LKE+Q VC P M+KMHG   G A      G+G    G
Sbjct:  450 DNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDRMLAEAEQYKEEDNRQRDRVSARNQLESYVFNVKQALDEAGDKLSEQDKETARRECDEALKWLDNNALADKEEYEHKLKEIQRVCMPAMSKMHGASAGGATDCHQQGSGSQHSG 628          
BLAST of HiSeq13029 vs. genbank:protein
Match: gi|526299382|gb|AGR84224.1| (heat shock protein 70-2 [Melitaea cinxia])

HSP 1 Score: 286.96 bits (733), Expect = 8.133e-91
Identity = 136/173 (78.61%), Postives = 154/173 (89.02%), Query Frame = 0
Query:    1 DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKIVIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVCQPLMTKMHGGGQAQGGMPGGAGG 173
            DNNLLG F+LTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRS+ IVIKND+GRLSQAEIDRMLA+AE+YKEED+RQR+RV+ARN+LE+YVF VKQALDEAGDKLSEQDK+T RREC+E L+WLDNN LA++EEYEH+LKE+Q VC P M+KMHG         GGA G
Sbjct:  450 DNNLLGRFDLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSKNIVIKNDKGRLSQAEIDRMLAEAEQYKEEDNRQRDRVSARNQLESYVFNVKQALDEAGDKLSEQDKETARRECDEALKWLDNNTLADKEEYEHKLKEIQRVCMPAMSKMHGAS------AGGATG 616          
The following BLAST results are available for this feature:
BLAST of HiSeq13029 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|317135488|gb|ADV03160.1|3.075e-9476.76heat shock protein 70 [Spodoptera litura][more]
gi|930677533|gb|KPJ17592.1|8.622e-9381.01Heat shock protein 68 [Papilio machaon][more]
gi|943943041|ref|XP_014355014.1|1.087e-9281.01PREDICTED: heat shock protein 68-like [Papilio mac... [more]
gi|943456515|gb|ALL42052.1|1.260e-9281.93heat shock protein 70-2 [Antheraea pernyi][more]
gi|985425888|ref|XP_015378435.1|4.944e-9272.32PREDICTED: heat shock protein 70 B2-like, partial ... [more]
gi|909554702|ref|XP_013148831.1|1.377e-9176.57PREDICTED: heat shock protein 68-like [Papilio pol... [more]
gi|938485353|gb|AFK93489.2|1.767e-9184.81HSP70-1 [Cydia pomonella][more]
gi|1058121695|gb|JAS64496.1|2.933e-9176.22hypothetical protein g.13397, partial [Cuerna arid... [more]
gi|526299367|gb|AGR84223.1|2.966e-9177.09heat shock protein 70-2 [Melitaea cinxia][more]
gi|526299382|gb|AGR84224.1|8.133e-9178.61heat shock protein 70-2 [Melitaea cinxia][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005524 ATP binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 64..85
NoneNo IPR availableCOILSCoilCoilcoord: 129..150
NoneNo IPR availablePANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 1..188
IPR029048Heat shock protein 70kD, C-terminal domainGENE3D1.20.1270.10coord: 68..171
e-value: 4.0E-36
score: 123.0
IPR029048Heat shock protein 70kD, C-terminal domainSUPERFAMILY100934Heat shock protein 70kD (HSP70), C-terminal subdomaincoord: 87..165
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 1..158
e-value: 1.6E-42
score: 145.1
IPR029047Heat shock protein 70kD, peptide-binding domainGENE3D2.60.34.10coord: 1..67
e-value: 1.2E-29
score: 102.3
IPR029047Heat shock protein 70kD, peptide-binding domainSUPERFAMILY100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 1..92

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13029HiSeq13029Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13029_p ID=HiSeq13029_p|Name=HiSeq13029|organism=Ostrinia scapulalis|type=polypeptide|length=189bp
DNNLLGTFNLTGIPPAPRGVPKIDVTFDLDANGILNVSAKENSTGRSEKI
VIKNDRGRLSQAEIDRMLADAEKYKEEDDRQRERVAARNKLEAYVFGVKQ
ALDEAGDKLSEQDKDTGRRECEETLRWLDNNALAEREEYEHRLKEVQNVC
QPLMTKMHGGGQAQGGMPGGAGGMPGGMPGGMGGMPGGM
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
Vocabulary: INTERPRO
TermDefinition
IPR029047HSP70_peptide-bd
IPR013126Hsp_70_fam
IPR029048HSP70_C