HiSeq13030_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13030
Unique NameHiSeq13030_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length312
Homology
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295549|ref|XP_013198117.1| (PREDICTED: heat shock protein 68-like isoform X12 [Amyelois transitella] >gi|913326189|ref|XP_013194491.1| PREDICTED: heat shock protein 68-like isoform X12 [Amyelois transitella] >gi|913326217|ref|XP_013194506.1| PREDICTED: heat shock protein 68-like isoform X12 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295546|ref|XP_013198052.1| (PREDICTED: heat shock protein 68-like isoform X11 [Amyelois transitella] >gi|913326187|ref|XP_013194490.1| PREDICTED: heat shock protein 68-like isoform X11 [Amyelois transitella] >gi|913326215|ref|XP_013194505.1| PREDICTED: heat shock protein 68-like isoform X11 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295543|ref|XP_013197979.1| (PREDICTED: heat shock protein 68-like isoform X10 [Amyelois transitella] >gi|913326185|ref|XP_013194489.1| PREDICTED: heat shock protein 68-like isoform X10 [Amyelois transitella] >gi|913326213|ref|XP_013194504.1| PREDICTED: heat shock protein 68-like isoform X10 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295540|ref|XP_013197911.1| (PREDICTED: heat shock protein 68-like isoform X9 [Amyelois transitella] >gi|913326183|ref|XP_013194488.1| PREDICTED: heat shock protein 68-like isoform X9 [Amyelois transitella] >gi|913326211|ref|XP_013194503.1| PREDICTED: heat shock protein 68-like isoform X9 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295537|ref|XP_013197838.1| (PREDICTED: heat shock protein 68-like isoform X8 [Amyelois transitella] >gi|913326181|ref|XP_013194487.1| PREDICTED: heat shock protein 68-like isoform X8 [Amyelois transitella] >gi|913326209|ref|XP_013194502.1| PREDICTED: heat shock protein 68-like isoform X8 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295534|ref|XP_013197774.1| (PREDICTED: heat shock protein 68-like isoform X7 [Amyelois transitella] >gi|913326179|ref|XP_013194486.1| PREDICTED: heat shock protein 68-like isoform X7 [Amyelois transitella] >gi|913326207|ref|XP_013194501.1| PREDICTED: heat shock protein 68-like isoform X7 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295531|ref|XP_013197702.1| (PREDICTED: heat shock protein 68-like isoform X6 [Amyelois transitella] >gi|913326177|ref|XP_013194485.1| PREDICTED: heat shock protein 68-like isoform X6 [Amyelois transitella] >gi|913326205|ref|XP_013194500.1| PREDICTED: heat shock protein 68-like isoform X6 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295528|ref|XP_013197637.1| (PREDICTED: heat shock protein 68-like isoform X5 [Amyelois transitella] >gi|913326175|ref|XP_013194484.1| PREDICTED: heat shock protein 68-like isoform X5 [Amyelois transitella] >gi|913326203|ref|XP_013194499.1| PREDICTED: heat shock protein 68-like isoform X5 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295525|ref|XP_013197570.1| (PREDICTED: heat shock protein 68-like isoform X4 [Amyelois transitella] >gi|913326173|ref|XP_013194483.1| PREDICTED: heat shock protein 68-like isoform X4 [Amyelois transitella] >gi|913326201|ref|XP_013194498.1| PREDICTED: heat shock protein 68-like isoform X4 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
BLAST of HiSeq13030 vs. genbank:protein
Match: gi|913295522|ref|XP_013197499.1| (PREDICTED: heat shock protein 68-like isoform X3 [Amyelois transitella] >gi|913326171|ref|XP_013194482.1| PREDICTED: heat shock protein 68-like isoform X3 [Amyelois transitella] >gi|913326199|ref|XP_013194497.1| PREDICTED: heat shock protein 68-like isoform X3 [Amyelois transitella])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 300/312 (96.15%), Postives = 309/312 (99.04%), Query Frame = 0
Query:    1 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSDLFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKKLNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGGVMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 312
            DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEV+ATAGDTHLGGEDFDNRLVNHLA+EFKRKYKKDLR NPRALRRLRTAAERAKRTLSSSTEAT+EIDALYEGIDFYTRVSRARFEELCSDLFR TLEPVEKALRDAK+DKSQIHDVVLVGGSTRIPKIQ+LLQ LFCGKKLNLSINPDEAVAYGAAVQAAILSG+TDTRIQDVLLVDV+PLSLGIETAGGVMTKIIERNSKIPC+Q+QTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG
Sbjct:  157 DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRLVNHLADEFKRKYKKDLRMNPRALRRLRTAAERAKRTLSSSTEATIEIDALYEGIDFYTRVSRARFEELCSDLFRGTLEPVEKALRDAKLDKSQIHDVVLVGGSTRIPKIQSLLQGLFCGKKLNLSINPDEAVAYGAAVQAAILSGSTDTRIQDVLLVDVAPLSLGIETAGGVMTKIIERNSKIPCKQSQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGTFDLTGIPPAPRG 468          
The following BLAST results are available for this feature:
BLAST of HiSeq13030 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913295549|ref|XP_013198117.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X12 ... [more]
gi|913295546|ref|XP_013198052.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X11 ... [more]
gi|913295543|ref|XP_013197979.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X10 ... [more]
gi|913295540|ref|XP_013197911.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X9 [... [more]
gi|913295537|ref|XP_013197838.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X8 [... [more]
gi|913295534|ref|XP_013197774.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X7 [... [more]
gi|913295531|ref|XP_013197702.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X6 [... [more]
gi|913295528|ref|XP_013197637.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X5 [... [more]
gi|913295525|ref|XP_013197570.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X4 [... [more]
gi|913295522|ref|XP_013197499.1|0.000e+096.15PREDICTED: heat shock protein 68-like isoform X3 [... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 102..123
NoneNo IPR availableGENE3D3.90.640.10coord: 73..153
e-value: 1.6E-39
score: 133.3
NoneNo IPR availableGENE3D3.30.420.40coord: 158..201
e-value: 1.6E-37
score: 126.2
coord: 43..72
e-value: 1.6E-37
score: 126.2
NoneNo IPR availableGENE3D3.30.420.40coord: 1..42
e-value: 1.1E-20
score: 73.3
NoneNo IPR availablePANTHERPTHR19375:SF142HEAT SHOCK 70 KDA PROTEIN COGNATE 1-RELATEDcoord: 1..312
NoneNo IPR availablePANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 1..312
NoneNo IPR availableSUPERFAMILY53067Actin-like ATPase domaincoord: 31..224
NoneNo IPR availableSUPERFAMILY53067Actin-like ATPase domaincoord: 1..28
IPR013126Heat shock protein 70 familyPRINTSPR00301HEATSHOCK70coord: 232..251
score: 78.25
coord: 44..54
score: 81.18
coord: 205..225
score: 79.57
coord: 173..189
score: 76.74
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 1..312
e-value: 5.6E-145
score: 483.5
IPR029047Heat shock protein 70kD, peptide-binding domainGENE3D2.60.34.10coord: 211..312
e-value: 4.0E-47
score: 159.8
IPR029047Heat shock protein 70kD, peptide-binding domainSUPERFAMILY100920Heat shock protein 70kD (HSP70), peptide-binding domaincoord: 229..312
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 38..51

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13030HiSeq13030Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13030_p ID=HiSeq13030_p|Name=HiSeq13030|organism=Ostrinia scapulalis|type=polypeptide|length=312bp
DAGAIAGLNVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSI
LTIDEGSLFEVRATAGDTHLGGEDFDNRLVNHLAEEFKRKYKKDLRSNPR
ALRRLRTAAERAKRTLSSSTEATVEIDALYEGIDFYTRVSRARFEELCSD
LFRSTLEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQNLLQTLFCGKK
LNLSINPDEAVAYGAAVQAAILSGNTDTRIQDVLLVDVSPLSLGIETAGG
VMTKIIERNSKIPCRQAQTFTTYSDNQPAVTIQVYEGERAMTKDNNLLGT
FDLTGIPPAPRG
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR018181Heat_shock_70_CS
IPR029047HSP70_peptide-bd
IPR013126Hsp_70_fam