HiSeq13047_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13047
Unique NameHiSeq13047_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length166
Homology
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|1073525643|gb|JAT79933.1| (hypothetical protein g.6467 [Pectinophora gossypiella])

HSP 1 Score: 263.462 bits (672), Expect = 7.027e-87
Identity = 126/165 (76.36%), Postives = 145/165 (87.88%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPKIFAQNKD 165
            MIIFLS+LQKEHL+LLH HSTQVLVDFCKL+I+YLNNG N KKY+VAAEKL+V +  IQN+V+AL YL+VEACKHNLSD DFKSS+A+AGFSSE QEVL+KLY TKK ELS AL LLQQK+PTYQDL WRFEIQVAS+   E++KP VA+DF+LMTPK F QNKD
Sbjct:    1 MIIFLSDLQKEHLSLLHQHSTQVLVDFCKLAIEYLNNGSNGKKYAVAAEKLNVALPMIQNVVHALVYLIVEACKHNLSDGDFKSSLALAGFSSEQQEVLLKLYVTKKTELSGALYLLQQKDPTYQDLRWRFEIQVASRHCEEQIKPMVAVDFILMTPKHFGQNKD 165          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|913327106|ref|XP_013194994.1| (PREDICTED: COMM domain-containing protein 2-like [Amyelois transitella])

HSP 1 Score: 250.366 bits (638), Expect = 8.713e-82
Identity = 113/162 (69.75%), Postives = 139/162 (85.80%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPKIFAQ 162
            MIIFLSELQK+HL+LL  HSTQVL+DFCKL+IDYLNNGIN KKY +AAEKL V V  +QNLV+AL YL+VEACKH LS+PDFKSS+ IAGFS E Q+VLVKLY+ K AE+SS+L+LLQQ+EP+YQD TWRFE+QVA++  +EE+KP ++M+F + TPK F Q
Sbjct:    1 MIIFLSELQKDHLSLLQKHSTQVLIDFCKLAIDYLNNGINEKKYGIAAEKLGVSVVAVQNLVHALLYLIVEACKHKLSEPDFKSSLGIAGFSEEQQDVLVKLYSAKNAEISSSLSLLQQREPSYQDFTWRFEVQVATKSCMEEIKPMISMNFTVTTPKNFGQ 162          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|357623158|gb|EHJ74418.1| (putative COMM domain containing 2 [Danaus plexippus])

HSP 1 Score: 244.973 bits (624), Expect = 1.236e-79
Identity = 119/166 (71.69%), Postives = 138/166 (83.13%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTP-KIFAQNKD 165
            MIIFLS+LQKEHL LLH HS QVLVDFCKL+ID+LNNGIN KK ++AAE+L+VP + IQNL+YAL YLLVE CKHNL + +F SS+AIAGFS EHQ+VL+KLY TKK E+S ALNLLQQ E +YQDL WRFEIQVASQ S EE+ P VAMDFVL TP K+   N+D
Sbjct:    1 MIIFLSDLQKEHLKLLHEHSAQVLVDFCKLTIDFLNNGINQKKCAIAAERLNVPPSVIQNLIYALAYLLVEGCKHNLLETNFNSSLAIAGFSPEHQQVLLKLYNTKKKEISEALNLLQQSEASYQDLLWRFEIQVASQNSNEEIIPMVAMDFVLSTPKKVSEHNED 166          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|509176705|gb|JAA86473.1| (COMM domain-containing protein 2 [Pararge aegeria])

HSP 1 Score: 243.817 bits (621), Expect = 3.380e-79
Identity = 114/162 (70.37%), Postives = 140/162 (86.42%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPKIFAQ 162
            MIIFLSELQKEHL+LLH HSTQVLVDFCKL+IDYL NG+N KK ++AAEKLD+    +QNL++AL YL+VEACKHNLS+ +F SS+AIAGFS + Q+VL+KLY TKK E+S+ALNLLQQK+P+YQDL+WRFEIQ+AS+ S EE+ P +AMDFVL TPK + Q
Sbjct:    1 MIIFLSELQKEHLHLLHQHSTQVLVDFCKLTIDYLCNGMNQKKCAIAAEKLDISALVVQNLLHALAYLIVEACKHNLSETNFVSSLAIAGFSEDKQKVLLKLYNTKKGEISAALNLLQQKDPSYQDLSWRFEIQIASKMSHEEIVPMIAMDFVLTTPKNYGQ 162          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|909577084|ref|XP_013144348.1| (PREDICTED: COMM domain-containing protein 2-like [Papilio polytes])

HSP 1 Score: 242.662 bits (618), Expect = 8.472e-79
Identity = 112/165 (67.88%), Postives = 140/165 (84.85%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPKIFAQNKD 165
            MIIFLSELQKEHL++LH  S QVLVDFCKL+IDYLNNG+N +K +VAAEKL +P+T IQNL+ AL YL++E CKHNLSD DFKSS+A+AGFS+EHQ+VL+KLY TKK ELSSALN+LQQK+P+YQDLTWRFE+Q+AS++    +KP + ++ V+  PK F QN D
Sbjct:    1 MIIFLSELQKEHLDILHKQSLQVLVDFCKLTIDYLNNGVNSEKCTVAAEKLGLPLTYIQNLIQALAYLILEGCKHNLSDTDFKSSLALAGFSNEHQQVLLKLYITKKDELSSALNILQQKDPSYQDLTWRFEVQMASRRCNHMIKPMITLNLVVTIPKNFGQNVD 165          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|943954822|ref|XP_014360366.1| (PREDICTED: COMM domain-containing protein 2-like isoform X1 [Papilio machaon] >gi|930673039|gb|KPJ13587.1| COMM domain-containing protein 2 [Papilio machaon])

HSP 1 Score: 239.58 bits (610), Expect = 1.248e-77
Identity = 111/165 (67.27%), Postives = 137/165 (83.03%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPKIFAQNKD 165
            MIIFLSELQKEHL++LH  S QVLVDFCKL+IDYLNNGIN +KY++AAEKL +P+  IQNL+ AL YL++E CKHNLS  DFKSS+A+AGFS+EHQ+VL+KLY TKK ELSSALN+LQQKEP YQDLTWRFE+Q+AS++    +KP + ++ V+  PK F  N D
Sbjct:    1 MIIFLSELQKEHLDVLHKQSLQVLVDFCKLTIDYLNNGINNEKYTIAAEKLGIPLAFIQNLIQALAYLILEGCKHNLSQTDFKSSLALAGFSNEHQQVLLKLYITKKDELSSALNVLQQKEPNYQDLTWRFEVQMASRRCNNMIKPMITLNLVVTIPKNFGHNVD 165          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|914615370|ref|NP_001299443.1| (uncharacterized protein LOC106117045 [Papilio xuthus] >gi|389610363|dbj|BAM18793.1| unknown unsecreted protein [Papilio xuthus])

HSP 1 Score: 239.195 bits (609), Expect = 1.811e-77
Identity = 111/165 (67.27%), Postives = 138/165 (83.64%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPKIFAQNKD 165
            MIIFLSELQKEHL++LH  S QVLVDFCKL+IDYLNNGIN +KY++AAEKL + V  IQNL+ AL YL++E CKHNLS+ DFKSS+A+AGFS+EHQ+VL+KLY TKK ELSSALN+LQQK+P+YQDLTWRFEIQ+AS++    +KP + ++ V+  PK F Q  D
Sbjct:    1 MIIFLSELQKEHLDVLHKQSLQVLVDFCKLTIDYLNNGINSEKYTIAAEKLGISVAYIQNLIQALAYLILEGCKHNLSETDFKSSLALAGFSNEHQQVLLKLYITKKDELSSALNILQQKDPSYQDLTWRFEIQMASRRCNNMIKPMITLNLVVTIPKNFGQTID 165          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|930650998|gb|KPI93342.1| (COMM domain-containing protein 2 [Papilio xuthus])

HSP 1 Score: 239.195 bits (609), Expect = 2.064e-77
Identity = 111/165 (67.27%), Postives = 138/165 (83.64%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPKIFAQNKD 165
            MIIFLSELQKEHL++LH  S QVLVDFCKL+IDYLNNGIN +KY++AAEKL + V  IQNL+ AL YL++E CKHNLS+ DFKSS+A+AGFS+EHQ+VL+KLY TKK ELSSALN+LQQK+P+YQDLTWRFEIQ+AS++    +KP + ++ V+  PK F Q  D
Sbjct:    1 MIIFLSELQKEHLDVLHKQSLQVLVDFCKLTIDYLNNGINSEKYTIAAEKLGISVAYIQNLIQALAYLILEGCKHNLSETDFKSSLALAGFSNEHQQVLLKLYITKKDELSSALNILQQKDPSYQDLTWRFEIQMASRRCNNMIKPMITLNLVVTIPKNFGQTID 165          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|914558691|gb|KOB66764.1| (COMM domain-containing protein 2 [Operophtera brumata])

HSP 1 Score: 236.498 bits (602), Expect = 2.811e-76
Identity = 112/164 (68.29%), Postives = 136/164 (82.93%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPKIFAQNK 164
            MIIFLSELQKEHLNLLH + TQVL+DFCKLS+DYL+NGIN KKY+VAAEKL++ V+ +QNL+ AL YL+VE  KHNLS+ DFKSS+AIAGFS E Q VL +L+  KK ELS AL LLQQK+ TYQD +WRFEIQVAS+  +E++KP + M+FV+MTPK F Q K
Sbjct:    1 MIIFLSELQKEHLNLLHQYPTQVLIDFCKLSLDYLSNGINAKKYNVAAEKLNITVSDVQNLILALIYLIVEGSKHNLSESDFKSSLAIAGFSDEKQLVLARLHTAKKPELSQALYLLQQKDATYQDFSWRFEIQVASRNHMEQIKPMITMNFVIMTPKNFGQFK 164          
BLAST of HiSeq13047 vs. genbank:protein
Match: gi|768432383|ref|XP_011557513.1| (PREDICTED: uncharacterized protein LOC105388323 [Plutella xylostella])

HSP 1 Score: 224.942 bits (572), Expect = 1.191e-71
Identity = 108/158 (68.35%), Postives = 129/158 (81.65%), Query Frame = 0
Query:    1 MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEKLDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLVKLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAMDFVLMTPK 158
            MIIFLSELQK+HLNL+   S QVLVDFCKL+IDYL+NGIN  KYS AA K D  +T IQNLV+A+ +LLVE  KHNLSD DFKSS+AIAGF +EHQEVL+KLY TKK+E+S  L++LQQ +  YQDLTWR E++VAS+ + E VKP V+MDFVLM PK
Sbjct:    1 MIIFLSELQKDHLNLVTKQSPQVLVDFCKLAIDYLSNGINHAKYSTAANKFDTSITNIQNLVHAIVFLLVEGSKHNLSDCDFKSSLAIAGFPAEHQEVLIKLYNTKKSEISECLHVLQQADLVYQDLTWRMEVEVASRCNNETVKPNVSMDFVLMKPK 158          
The following BLAST results are available for this feature:
BLAST of HiSeq13047 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1073525643|gb|JAT79933.1|7.027e-8776.36hypothetical protein g.6467 [Pectinophora gossypie... [more]
gi|913327106|ref|XP_013194994.1|8.713e-8269.75PREDICTED: COMM domain-containing protein 2-like [... [more]
gi|357623158|gb|EHJ74418.1|1.236e-7971.69putative COMM domain containing 2 [Danaus plexippu... [more]
gi|509176705|gb|JAA86473.1|3.380e-7970.37COMM domain-containing protein 2 [Pararge aegeria][more]
gi|909577084|ref|XP_013144348.1|8.472e-7967.88PREDICTED: COMM domain-containing protein 2-like [... [more]
gi|943954822|ref|XP_014360366.1|1.248e-7767.27PREDICTED: COMM domain-containing protein 2-like i... [more]
gi|914615370|ref|NP_001299443.1|1.811e-7767.27uncharacterized protein LOC106117045 [Papilio xuth... [more]
gi|930650998|gb|KPI93342.1|2.064e-7767.27COMM domain-containing protein 2 [Papilio xuthus][more]
gi|914558691|gb|KOB66764.1|2.811e-7668.29COMM domain-containing protein 2 [Operophtera brum... [more]
gi|768432383|ref|XP_011557513.1|1.191e-7168.35PREDICTED: uncharacterized protein LOC105388323 [P... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009886HCaRGPFAMPF07258HCaRGcoord: 15..156
e-value: 7.5E-21
score: 74.3
NoneNo IPR availablePANTHERPTHR15857COMM DOMAIN CONTAINING PROTEIN 2coord: 2..155

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13047HiSeq13047Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13047_p ID=HiSeq13047_p|Name=HiSeq13047|organism=Ostrinia scapulalis|type=polypeptide|length=166bp
MIIFLSELQKEHLNLLHNHSTQVLVDFCKLSIDYLNNGINLKKYSVAAEK
LDVPVTTIQNLVYALTYLLVEACKHNLSDPDFKSSIAIAGFSSEHQEVLV
KLYATKKAELSSALNLLQQKEPTYQDLTWRFEIQVASQKSLEEVKPTVAM
DFVLMTPKIFAQNKDX
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR009886HCaRG