HiSeq13049_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13049
Unique NameHiSeq13049_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length435
Homology
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|943972181|ref|XP_014367606.1| (PREDICTED: alpha-(1,3)-fucosyltransferase 6-like [Papilio machaon])

HSP 1 Score: 386.341 bits (991), Expect = 5.999e-128
Identity = 184/367 (50.14%), Postives = 262/367 (71.39%), Query Frame = 0
Query:   71 LGNIKFRNDXLFKNQPIKYKPQNRTFTVLVYKHWHWFKHRHM-----TKK--SFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPW-VDKRNTTQRWVFLTEESPIHTFIHPDP--NISDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILCK 427
            LG + F+ND +  N+ I+   +N+TFTV+++K+W+W +HRHM     ++K  S   CSV NC F   D+  ++ DAVVVH+Q   FP    KRN  QRW+FL++ESP++ F   +   N+ D++  +NWSMTYRS+SDVP+PYGR VP+PE ++ E A  PIT  IP W +K++ VL A LISHC V +R+ ++ EL+K++ +D++G C+ N   KNSCPGH  ADCP +++YLFYL FENSKC++YLTEK +++AY KGAIP++MGP V +C KLLPP+SFLHV  YD+  ELAMEI+ +S +     L+H+WR +F VINEHG+ G+ S   CR+CEALNYND   K+YDE+ ++ + D++  C+
Sbjct:   83 LGTVLFKNDDI--NKYIRKDNENKTFTVVIWKYWNWLQHRHMYSFGASQKDISLEGCSVKNCVFPKNDQGFDTADAVVVHVQHGLFPNNTKKRNPHQRWIFLSDESPVNAFFQSERRINLEDLAYMFNWSMTYRSESDVPVPYGRTVPLPEPII-ETAEKPITDLIPNWSKKRQDVLAAILISHCGVSYRIEFVNELKKHLSLDVHGSCSEN--HKNSCPGHFRADCPVISEYLFYLVFENSKCQEYLTEKSFYHAYSKGAIPVIMGPTVEECEKLLPPDSFLHVDNYDTVEELAMEIINISKDMPRLLLYHEWRRHFQVINEHGYFGSKSQHYCRICEALNYNDQDVKIYDEDMLRPFFDKSSACR 444          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|930667019|gb|KPJ08107.1| (Alpha-(1,3)-fucosyltransferase [Papilio machaon])

HSP 1 Score: 386.726 bits (992), Expect = 1.602e-127
Identity = 184/367 (50.14%), Postives = 262/367 (71.39%), Query Frame = 0
Query:   71 LGNIKFRNDXLFKNQPIKYKPQNRTFTVLVYKHWHWFKHRHM-----TKK--SFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPW-VDKRNTTQRWVFLTEESPIHTFIHPDP--NISDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILCK 427
            LG + F+ND +  N+ I+   +N+TFTV+++K+W+W +HRHM     ++K  S   CSV NC F   D+  ++ DAVVVH+Q   FP    KRN  QRW+FL++ESP++ F   +   N+ D++  +NWSMTYRS+SDVP+PYGR VP+PE ++ E A  PIT  IP W +K++ VL A LISHC V +R+ ++ EL+K++ +D++G C+ N   KNSCPGH  ADCP +++YLFYL FENSKC++YLTEK +++AY KGAIP++MGP V +C KLLPP+SFLHV  YD+  ELAMEI+ +S +     L+H+WR +F VINEHG+ G+ S   CR+CEALNYND   K+YDE+ ++ + D++  C+
Sbjct:  128 LGTVLFKNDDI--NKYIRKDNENKTFTVVIWKYWNWLQHRHMYSFGASQKDISLEGCSVKNCVFPKNDQGFDTADAVVVHVQHGLFPNNTKKRNPHQRWIFLSDESPVNAFFQSERRINLEDLAYMFNWSMTYRSESDVPVPYGRTVPLPEPII-ETAEKPITDLIPNWSKKRQDVLAAILISHCGVSYRIEFVNELKKHLSLDVHGSCSEN--HKNSCPGHFRADCPVISEYLFYLVFENSKCQEYLTEKSFYHAYSKGAIPVIMGPTVEECEKLLPPDSFLHVDNYDTVEELAMEIINISKDMPRLLLYHEWRRHFQVINEHGYFGSKSQHYCRICEALNYNDQDVKIYDEDMLRPFFDKSSACR 489          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|909575570|ref|XP_013143526.1| (PREDICTED: alpha-(1,3)-fucosyltransferase 6-like isoform X2 [Papilio polytes])

HSP 1 Score: 381.333 bits (978), Expect = 4.633e-126
Identity = 187/366 (51.09%), Postives = 253/366 (69.13%), Query Frame = 0
Query:   71 LGNIKFRNDXLFKNQPIKYKPQNRTFTVLVYKHWHWFKHRHM-----TKK--SFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPW-VDKRNTTQRWVFLTEESPIHTFIHPDPNI--SDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILC 426
            LG+I F+N  +  N   +   + RTFT++++K+W+W +HRHM     ++K  S   CSV NC F   D+  ++ DAVVVH+Q   FP    KRN  QRW+FL++ESP++ F   +  I   DI NT+NWSMTYRS+SDVP+PYGR +P+ E L   MA  PI   IP W +K++ VL A LISHC V +RMNY+ EL+K++ +D++G C+ N   KNSCPGH  ADCP +++YLFYL FENSKC++YLTEK +++AY KGAIP++MGP V +C  LLPP+SFLHV  YD+  ELAM+I+ +S +     L+H+WR +F VINEHG+ G+ S   CR+CEALNYND G K+YDE  +K Y D    C
Sbjct:   83 LGSILFKNADV--NVYRRKDTEKRTFTIVIWKYWNWLQHRHMYSFGASQKDISLEGCSVKNCVFPKNDRDFDTADAVVVHVQHGLFPNNTKKRNPRQRWIFLSDESPVNAFFQSERRIKLQDIVNTFNWSMTYRSESDVPVPYGRTIPLLESL-EAMAEKPINDIIPNWSKKRQDVLAAILISHCGVSYRMNYVNELKKHLNLDVHGSCSEN--HKNSCPGHFRADCPIISEYLFYLVFENSKCQEYLTEKAFYHAYSKGAIPVIMGPTVQECETLLPPDSFLHVDNYDTVEELAMDIINISKDLPRLLLYHEWRRHFKVINEHGYFGSKSQHYCRICEALNYNDEGVKIYDENMLKPYFDVASTC 443          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|827563342|ref|XP_012552257.1| (PREDICTED: alpha-(1,3)-fucosyltransferase 7-like [Bombyx mori])

HSP 1 Score: 379.793 bits (974), Expect = 1.600e-125
Identity = 187/380 (49.21%), Postives = 258/380 (67.89%), Query Frame = 0
Query:   58 IDXXXDNTQELEA--LGNIKF-RNDXLFKNQPIKYKPQNRTFTVLVYKHWHWFKHRHMTKKS------FATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPWVDKRNTTQRWVFLTEESPIHTFIHPD--PNISDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILC 426
            ID   D  ++L+   LG+I F RND   KN  +  K  NRTFTVL+++HW W K+RH+ + S         CSVNNC+F G ++L++ VDAVVVH+Q+   P V  R  TQRW+FLT+ESPIH F +    PN+SD+ N +NWSMTYR+D+D+P+PYGR +P+   +  E     ITK IP W+ K R VL + L+S+C VP+RM Y+ +L+K++K+DI+G C+ +  + NSCPGH  ADC  ++ YLFY   ENS C++Y+TEK++H AY KGAIPI+ GPP+ DC +LLPPNSFLH+  Y SP++LA EI  ++ N++    +H WR +F VINEHG+ GT S   CR+CEALNYND    VYD   +  ++D +  C
Sbjct:   63 IDQYYDYRKDLKTSNLGSILFKRND---KNTLLVEK--NRTFTVLIWRHWEWLKYRHIFRYSSTPHNPLEDCSVNNCEFTGNNRLLDKVDAVVVHLQKGVLPNVYNRTRTQRWIFLTDESPIHLFENEKNRPNLSDLVNVFNWSMTYRTDADIPVPYGRTIPLEAPIFTETTNTNITKLIPNWKNKMRDVLASILMSNCGVPYRMKYLNKLKKHMKIDIHGKCSDS-HLVNSCPGHFRADCKIISNYLFYFVLENSLCKEYITEKLFHQAYAKGAIPIIQGPPLEDCKRLLPPNSFLHLDEYRSPKKLANEIRNITSNEDNLLSYHLWRNHFQVINEHGYFGTKSYHYCRICEALNYNDETESVYDSVRINNFMDASKSC 436          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|357616373|gb|EHJ70157.1| (putative alpha1,3-fucosyltransferase B-like proteinue [Danaus plexippus])

HSP 1 Score: 377.867 bits (969), Expect = 4.776e-125
Identity = 173/361 (47.92%), Postives = 246/361 (68.14%), Query Frame = 0
Query:   81 LFKNQPIKY-----KPQNRTFTVLVYKHWHWFKHRHMTK-------KSFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPWVDKRNTTQRWVFLTEESPIHTFIHP--DPNISDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILCK 427
            L+KN PI         +N TF VL++KHW W K+RH+              CSV NCKF G+D+ +   DAV+VH+ +  FP    RN TQRW+FL +ESP + F      P + D+SN +NWSMTYRSDSDVP+PYGR VP+ + +++++ Y+ +   +PYWE K++ VL + L+SHC VP R  Y+++L++Y+ VD+YG C++N   KNSCPGH  +DC  ++KYLFYL FEN++C +Y+TEK+++NAY KGAIP++MGP +  C  LLPP+SFLH+  YD+P++LA  ++ +S + +    FH+WR  F V NEHG+ GT S  LCR+CEALNYND   K YDEE ++I+ D  + C+
Sbjct:   56 LYKNYPIDAISPAGSQRNTTFLVLIWKHWEWLKNRHIYSFDKNRPLDPLEDCSVKNCKFTGDDEKLLLADAVIVHVLKGLFPNTTTRNLTQRWIFLNDESPQNAFYAAVNKPKLKDLSNMFNWSMTYRSDSDVPVPYGRTVPLKKAILNQITYESLASLVPYWENKRKDVLASILMSHCGVPRRTEYLQKLQEYLTVDVYGKCSKN--NKNSCPGHFRSDCNLVSKYLFYLVFENTQCHEYMTEKLFYNAYSKGAIPVIMGPSIDCCEGLLPPDSFLHIDNYDNPQQLAEHMVEISEDLKKILRFHRWRNDFEVKNEHGYFGTRSYHLCRICEALNYNDQAVKYYDEEDLRIFFDPTLSCR 414          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|910331397|ref|XP_013169024.1| (PREDICTED: alpha-(1,3)-fucosyltransferase 6-like isoform X1 [Papilio xuthus])

HSP 1 Score: 370.163 bits (949), Expect = 1.093e-121
Identity = 179/367 (48.77%), Postives = 255/367 (69.48%), Query Frame = 0
Query:   71 LGNIKFRNDXLFKNQPIKYKPQNRTFTVLVYKHWHWFKHRHM-----TKK--SFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPW-VDKRNTTQRWVFLTEESPIHTFIHPDPNI--SDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILCK 427
            LG I F+   +  N   K   +N+TF V+++K+W+W ++RHM     +KK  S   CSVNNC F  +D+  +S DAVVVH+Q   FP    +RN  QRW+FL++ESP+H F   +  I   D++  +NWSMTYRS+SDVP+PYGR +P+ + ++ E A  PIT  IP W +K++ VL A LISHC +  R+ Y+ EL+K++ +D++G C+ N   K+SCPGH  ADCP +++YLFYL FENSKC +YLTEK +++AY KGAIP++MGP V +C KLLPP+SFLHV  YD+P ELA+EI+ +S +     L+H+WR +F V+NEHG+ G+ S   CR+CEALNYND   K+YDE+ ++ + D +  C+
Sbjct:   83 LGTILFKKADI--NVYRKKANENKTFIVVIWKYWNWLQNRHMHSFGASKKDISLEGCSVNNCVFPKDDQDFDSADAVVVHVQHGLFPNNTKQRNPDQRWIFLSDESPVHAFFQSERRIKLQDLAYMFNWSMTYRSESDVPVPYGRTIPLSKPIV-ENAEIPITNIIPNWSKKRQDVLAAILISHCGISFRIQYVNELKKHLNLDVHGSCSEN--HKDSCPGHFRADCPIISEYLFYLVFENSKCEEYLTEKSFYHAYSKGAIPVIMGPTVEECEKLLPPDSFLHVDNYDTPEELAIEIINISKDMPRLLLYHEWRRHFQVVNEHGYFGSKSQHYCRICEALNYNDQDVKIYDEDMLRPFFDMSSACR 444          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|909575568|ref|XP_013143525.1| (PREDICTED: alpha-(1,3)-fucosyltransferase 6-like isoform X1 [Papilio polytes])

HSP 1 Score: 369.777 bits (948), Expect = 4.537e-121
Identity = 188/396 (47.47%), Postives = 252/396 (63.64%), Query Frame = 0
Query:   71 LGNIKFRNDXLFKNQPIKYKPQNRTFTVLVYKHWHWFKHRHM----------------------------TKKSF---------ATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPW-VDKRNTTQRWVFLTEESPIHTFIHPDPNI--SDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILC 426
            LG+I F+N  +  N   +   + RTFT++++K+W+W +HRHM                             KKS            CSV NC F   D+  ++ DAVVVH+Q   FP    KRN  QRW+FL++ESP++ F   +  I   DI NT+NWSMTYRS+SDVP+PYGR +P+ E L   MA  PI   IP W +K++ VL A LISHC V +RMNY+ EL+K++ +D++G C+ N   KNSCPGH  ADCP +++YLFYL FENSKC++YLTEK +++AY KGAIP++MGP V +C  LLPP+SFLHV  YD+  ELAM+I+ +S +     L+H+WR +F VINEHG+ G+ S   CR+CEALNYND G K+YDE  +K Y D    C
Sbjct:   83 LGSILFKNADV--NVYRRKDTEKRTFTIVIWKYWNWLQHRHMYSFGASQCWKRLREIITCGYGKIYQRYRRKKSLIDYRKDISLEGCSVKNCVFPKNDRDFDTADAVVVHVQHGLFPNNTKKRNPRQRWIFLSDESPVNAFFQSERRIKLQDIVNTFNWSMTYRSESDVPVPYGRTIPLLESL-EAMAEKPINDIIPNWSKKRQDVLAAILISHCGVSYRMNYVNELKKHLNLDVHGSCSEN--HKNSCPGHFRADCPIISEYLFYLVFENSKCQEYLTEKAFYHAYSKGAIPVIMGPTVQECETLLPPDSFLHVDNYDTVEELAMDIINISKDLPRLLLYHEWRRHFKVINEHGYFGSKSQHYCRICEALNYNDEGVKIYDENMLKPYFDVASTC 473          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|930660852|gb|KPJ02827.1| (Alpha-(1,3)-fucosyltransferase [Papilio xuthus])

HSP 1 Score: 367.466 bits (942), Expect = 1.204e-120
Identity = 178/367 (48.50%), Postives = 254/367 (69.21%), Query Frame = 0
Query:   71 LGNIKFRNDXLFKNQPIKYKPQNRTFTVLVYKHWHWFKHRHM-----TKK--SFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPW-VDKRNTTQRWVFLTEESPIHTFIHPDPNI--SDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILCK 427
            LG I F+   +  N   K   +N+TF V+++K+W+W ++RHM     +KK  S   CSVNNC F  +D+  +S DAVVVH+Q   FP    +RN  QRW+FL++ESP+H F   +  I   D++  +NWSMTYRS+SDVP+PYGR +P+ + ++ E A  PIT  IP W +K++ VL A LISHC +  R+ Y+ EL+K++ +D++G C+ N   K+SCPGH  ADCP +++YLFYL FENSKC +YLTEK +++AY KGAIP++MGP V +C KLLPP+SFLHV  YD+  ELA+EI+ +S +     L+H+WR +F V+NEHG+ G+ S   CR+CEALNYND   K+YDE+ ++ + D +  C+
Sbjct:   83 LGTILFKKADI--NVYRKKANENKTFIVVIWKYWNWLQNRHMHSFGASKKDISLEGCSVNNCVFPKDDQDFDSADAVVVHVQHGLFPNNTKQRNPDQRWIFLSDESPVHAFFQSERRIKLQDLAYMFNWSMTYRSESDVPVPYGRTIPLSKPIV-ENAEIPITNIIPNWSKKRQDVLAAILISHCGISFRIQYVNELKKHLNLDVHGSCSEN--HKDSCPGHFRADCPIISEYLFYLVFENSKCEEYLTEKSFYHAYSKGAIPVIMGPTVEECEKLLPPDSFLHVDNYDTAEELAIEIINISKDMPRLLLYHEWRRHFQVVNEHGYFGSKSQHYCRICEALNYNDQDVKIYDEDMLRPFFDMSSACR 444          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|913300031|ref|XP_013198570.1| (PREDICTED: alpha-(1,3)-fucosyltransferase 7-like [Amyelois transitella])

HSP 1 Score: 354.369 bits (908), Expect = 1.019e-116
Identity = 167/344 (48.55%), Postives = 237/344 (68.90%), Query Frame = 0
Query:   93 NRTFTVLVYKHWHWFKHRHM--------TKKSFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPWVDKRNTTQRWVFLTEESP--IHTFIHPDPNISDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILC 426
            ++TF +LV+K+W W K+RH+        ++++ + C+V NC FIG+D LINSVDAV+VH+ +   P V  RN  Q WVFL +ESP  I +  +  P++  + N +NWSMTYRSDSDVP+PYGR VP+   L  ++ Y  I + IP    K+  VLVA +IS+CNVP RMN+++EL+K+IK+D+YG C+++    N CPGH  ADC  +++Y FYL  ENSKC QY+TEKV+HNAY KGAIPI++GP V D   LLPPNS++H   Y+S  ELA +I+    N + +  +H WR YF ++NEHG+ G+ S  LCR+CEALNYN    K+Y  + ++ ++D ++LC
Sbjct:   14 SKTFVILVWKYWPWLKNRHIYNFNSKRSSQETLSNCTVKNCIFIGDDSLINSVDAVLVHIMRGVIPKVRHRNKKQIWVFLNDESPRNIFSLANKPPDLKTLENVFNWSMTYRSDSDVPVPYGRTVPLQRPLNFKITYRSIAESIPNLRTKRSNVLVAVVISNCNVPFRMNFLKELQKHIKIDVYGKCSKD--KNNECPGHFRADCHLVDQYYFYLVMENSKCHQYITEKVFHNAYSKGAIPILVGPSVNDSKMLLPPNSYIHSENYNSHEELAAKIIRTYQNIKKYLSYHLWRNYFEILNEHGYFGSKSYHLCRLCEALNYNKIEEKIYTLDDLRQFLDPSLLC 355          
BLAST of HiSeq13049 vs. genbank:protein
Match: gi|910331399|ref|XP_013169025.1| (PREDICTED: alpha-(1,3)-fucosyltransferase 6-like isoform X2 [Papilio xuthus])

HSP 1 Score: 346.28 bits (887), Expect = 5.647e-114
Identity = 161/315 (51.11%), Postives = 225/315 (71.43%), Query Frame = 0
Query:  116 SFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFPW-VDKRNTTQRWVFLTEESPIHTFIHPDPNI--SDISNTYNWSMTYRSDSDVPIPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHRMNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFENSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDSPRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEALNYNDNGTKVYDEESMKIYVDRNILCK 427
            S   CSVNNC F  +D+  +S DAVVVH+Q   FP    +RN  QRW+FL++ESP+H F   +  I   D++  +NWSMTYRS+SDVP+PYGR +P+ + ++ E A  PIT  IP W +K++ VL A LISHC +  R+ Y+ EL+K++ +D++G C+ N   K+SCPGH  ADCP +++YLFYL FENSKC +YLTEK +++AY KGAIP++MGP V +C KLLPP+SFLHV  YD+P ELA+EI+ +S +     L+H+WR +F V+NEHG+ G+ S   CR+CEALNYND   K+YDE+ ++ + D +  C+
Sbjct:   12 SLEGCSVNNCVFPKDDQDFDSADAVVVHVQHGLFPNNTKQRNPDQRWIFLSDESPVHAFFQSERRIKLQDLAYMFNWSMTYRSESDVPVPYGRTIPLSKPIV-ENAEIPITNIIPNWSKKRQDVLAAILISHCGISFRIQYVNELKKHLNLDVHGSCSEN--HKDSCPGHFRADCPIISEYLFYLVFENSKCEEYLTEKSFYHAYSKGAIPVIMGPTVEECEKLLPPDSFLHVDNYDTPEELAIEIINISKDMPRLLLYHEWRRHFQVVNEHGYFGSKSQHYCRICEALNYNDQDVKIYDEDMLRPFFDMSSACR 323          
The following BLAST results are available for this feature:
BLAST of HiSeq13049 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943972181|ref|XP_014367606.1|5.999e-12850.14PREDICTED: alpha-(1,3)-fucosyltransferase 6-like [... [more]
gi|930667019|gb|KPJ08107.1|1.602e-12750.14Alpha-(1,3)-fucosyltransferase [Papilio machaon][more]
gi|909575570|ref|XP_013143526.1|4.633e-12651.09PREDICTED: alpha-(1,3)-fucosyltransferase 6-like i... [more]
gi|827563342|ref|XP_012552257.1|1.600e-12549.21PREDICTED: alpha-(1,3)-fucosyltransferase 7-like [... [more]
gi|357616373|gb|EHJ70157.1|4.776e-12547.92putative alpha1,3-fucosyltransferase B-like protei... [more]
gi|910331397|ref|XP_013169024.1|1.093e-12148.77PREDICTED: alpha-(1,3)-fucosyltransferase 6-like i... [more]
gi|909575568|ref|XP_013143525.1|4.537e-12147.47PREDICTED: alpha-(1,3)-fucosyltransferase 6-like i... [more]
gi|930660852|gb|KPJ02827.1|1.204e-12048.50Alpha-(1,3)-fucosyltransferase [Papilio xuthus][more]
gi|913300031|ref|XP_013198570.1|1.019e-11648.55PREDICTED: alpha-(1,3)-fucosyltransferase 7-like [... [more]
gi|910331399|ref|XP_013169025.1|5.647e-11451.11PREDICTED: alpha-(1,3)-fucosyltransferase 6-like i... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006486 protein glycosylation
cellular_component GO:0016020 membrane
molecular_function GO:0008417 fucosyltransferase activity
molecular_function GO:0016740 transferase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001503Glycosyl transferase, family 10PFAMPF00852Glyco_transf_10coord: 88..412
e-value: 5.9E-68
score: 228.8
IPR001503Glycosyl transferase, family 10PANTHERPTHR11929ALPHA-(1,3)-FUCOSYLTRANSFERASEcoord: 117..411
NoneNo IPR availableSUPERFAMILY53756UDP-Glycosyltransferase/glycogen phosphorylasecoord: 86..409

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13049HiSeq13049Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13049_p ID=HiSeq13049_p|Name=HiSeq13049|organism=Ostrinia scapulalis|type=polypeptide|length=435bp
MTFTAGQKPPPKDQFXALPVPRFFRPVVAIRLFCPNGHQLYELKTXIIDR
CIEILHNIDXXXDNTQELEALGNIKFRNDXLFKNQPIKYKPQNRTFTVLV
YKHWHWFKHRHMTKKSFATCSVNNCKFIGEDKLINSVDAVVVHMQQKKFP
WVDKRNTTQRWVFLTEESPIHTFIHPDPNISDISNTYNWSMTYRSDSDVP
IPYGRVVPIPEELMHEMAYDPITKHIPYWEQKQRKVLVAALISHCNVPHR
MNYIRELEKYIKVDIYGGCARNLKMKNSCPGHTAADCPKLNKYLFYLAFE
NSKCRQYLTEKVYHNAYDKGAIPIVMGPPVADCVKLLPPNSFLHVSAYDS
PRELAMEILYLSINDEYFELFHKWRFYFSVINEHGFLGTTSLQLCRVCEA
LNYNDNGTKVYDEESMKIYVDRNILCKIGQPYTCH
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016740transferase activity
GO:0008417fucosyltransferase activity
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: INTERPRO
TermDefinition
IPR001503Glyco_trans_10