HiSeq13057_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13057
Unique NameHiSeq13057_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length267
Homology
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|913301304|ref|XP_013199965.1| (PREDICTED: uncharacterized protein LOC106142662 [Amyelois transitella])

HSP 1 Score: 476.478 bits (1225), Expect = 6.786e-168
Identity = 249/268 (92.91%), Postives = 253/268 (94.40%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSA-PTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAASPPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEG DYTAKEYLNFV HIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGK+P+ +A PTNGGSPLPSDESNLEPP TNGNGKL  DSVNEDTTTSCTEDSMDAKAAS   PATPASPSDNSDSA STPRAKRPIEEASSAEENSLGDS DA   P+AKKLREATH
Sbjct:   68 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGIDYTAKEYLNFVNHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKKPSLTAPPTNGGSPLPSDESNLEPP-TNGNGKLGPDSVNEDTTTSCTEDSMDAKAAS---PATPASPSDNSDSAFSTPRAKRPIEEASSAEENSLGDSSDATVAPLAKKLREATH 331          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|943972529|ref|XP_014367747.1| (PREDICTED: uncharacterized protein LOC106718229 isoform X2 [Papilio machaon])

HSP 1 Score: 474.552 bits (1220), Expect = 3.964e-167
Identity = 245/270 (90.74%), Postives = 257/270 (95.19%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSA---PTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAASPPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARG+FYPQLSYLIKVNTPRAVMQETKKAF+KLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTAKEYLNFVKHI+ VCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQP+LLGKEP   A   PTNGGSPLPSDESNLEPP+TNGNGKL  +SVNEDTTTSCTEDSMDAKAASP TPATPASPSDNSDSA+STPRAKR IEEASSAEENSLG++  A+APP+AKKLREATH
Sbjct:   68 MIHEELVQLMKWKQARGRFYPQLSYLIKVNTPRAVMQETKKAFKKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECIQAIPEMEGSDYTAKEYLNFVKHIRNVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPQLLGKEPVLPALPEPTNGGSPLPSDESNLEPPATNGNGKL--ESVNEDTTTSCTEDSMDAKAASPGTPATPASPSDNSDSAVSTPRAKRQIEEASSAEENSLGETPAAEAPPMAKKLREATH 335          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|943972532|ref|XP_014367748.1| (PREDICTED: uncharacterized protein LOC106718229 isoform X3 [Papilio machaon] >gi|943972534|ref|XP_014367749.1| PREDICTED: uncharacterized protein LOC106718229 isoform X3 [Papilio machaon])

HSP 1 Score: 468.389 bits (1204), Expect = 1.020e-165
Identity = 245/273 (89.74%), Postives = 257/273 (94.14%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSA---PTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAAS---PPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARG+FYPQLSYLIKVNTPRAVMQETKKAF+KLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTAKEYLNFVKHI+ VCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQP+LLGKEP   A   PTNGGSPLPSDESNLEPP+TNGNGKL  +SVNEDTTTSCTEDSMDAKAAS   P TPATPASPSDNSDSA+STPRAKR IEEASSAEENSLG++  A+APP+AKKLREATH
Sbjct:    1 MIHEELVQLMKWKQARGRFYPQLSYLIKVNTPRAVMQETKKAFKKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECIQAIPEMEGSDYTAKEYLNFVKHIRNVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPQLLGKEPVLPALPEPTNGGSPLPSDESNLEPPATNGNGKL--ESVNEDTTTSCTEDSMDAKAASPGTPATPATPASPSDNSDSAVSTPRAKRQIEEASSAEENSLGETPAAEAPPMAKKLREATH 271          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|943972526|ref|XP_014367746.1| (PREDICTED: uncharacterized protein LOC106718229 isoform X1 [Papilio machaon])

HSP 1 Score: 469.544 bits (1207), Expect = 4.644e-165
Identity = 245/273 (89.74%), Postives = 257/273 (94.14%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSA---PTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAAS---PPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARG+FYPQLSYLIKVNTPRAVMQETKKAF+KLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTAKEYLNFVKHI+ VCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQP+LLGKEP   A   PTNGGSPLPSDESNLEPP+TNGNGKL  +SVNEDTTTSCTEDSMDAKAAS   P TPATPASPSDNSDSA+STPRAKR IEEASSAEENSLG++  A+APP+AKKLREATH
Sbjct:   68 MIHEELVQLMKWKQARGRFYPQLSYLIKVNTPRAVMQETKKAFKKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECIQAIPEMEGSDYTAKEYLNFVKHIRNVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPQLLGKEPVLPALPEPTNGGSPLPSDESNLEPPATNGNGKL--ESVNEDTTTSCTEDSMDAKAASPGTPATPATPASPSDNSDSAVSTPRAKRQIEEASSAEENSLGETPAAEAPPMAKKLREATH 338          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|512912180|ref|XP_004927593.1| (PREDICTED: uncharacterized protein LOC101735385 isoform X3 [Bombyx mori])

HSP 1 Score: 464.922 bits (1195), Expect = 2.262e-164
Identity = 237/270 (87.78%), Postives = 248/270 (91.85%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSAPTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAAS---PPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTA+EYLNFV HI+ VCDRLN+EQNGCGKKW PHMVELALWTHNIVSDLQP+LLGKEPN     NGGSPLPSDESNLEPP+TNGNGKL  D VNEDTTTSCTEDSMDAKAAS   P TPATPASPSDNSDSA+STPR KR +EE SSAEENSLGDS +A  P +AKKLR+ATH
Sbjct:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECVQAIPEMEGSDYTAREYLNFVSHIRNVCDRLNEEQNGCGKKWFPHMVELALWTHNIVSDLQPQLLGKEPNNRPAANGGSPLPSDESNLEPPATNGNGKLVTDCVNEDTTTSCTEDSMDAKAASPSTPATPATPASPSDNSDSAVSTPRTKRQLEEGSSAEENSLGDSSEATLPNIAKKLRKATH 270          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|827549902|ref|XP_012547006.1| (PREDICTED: uncharacterized protein LOC101735385 isoform X1 [Bombyx mori])

HSP 1 Score: 466.077 bits (1198), Expect = 9.522e-164
Identity = 237/270 (87.78%), Postives = 248/270 (91.85%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSAPTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAAS---PPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTA+EYLNFV HI+ VCDRLN+EQNGCGKKW PHMVELALWTHNIVSDLQP+LLGKEPN     NGGSPLPSDESNLEPP+TNGNGKL  D VNEDTTTSCTEDSMDAKAAS   P TPATPASPSDNSDSA+STPR KR +EE SSAEENSLGDS +A  P +AKKLR+ATH
Sbjct:   68 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECVQAIPEMEGSDYTAREYLNFVSHIRNVCDRLNEEQNGCGKKWFPHMVELALWTHNIVSDLQPQLLGKEPNNRPAANGGSPLPSDESNLEPPATNGNGKLVTDCVNEDTTTSCTEDSMDAKAASPSTPATPATPASPSDNSDSAVSTPRTKRQLEEGSSAEENSLGDSSEATLPNIAKKLRKATH 337          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|910332075|ref|XP_013169385.1| (PREDICTED: uncharacterized protein LOC106119073 isoform X2 [Papilio xuthus] >gi|910332077|ref|XP_013169387.1| PREDICTED: uncharacterized protein LOC106119073 isoform X2 [Papilio xuthus])

HSP 1 Score: 459.529 bits (1181), Expect = 2.868e-162
Identity = 243/270 (90.00%), Postives = 255/270 (94.44%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSAPTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAAS---PPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARG+FYPQLSYLIKVNTPRAVMQETKKAF+KLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTAKEYLNFVKHI+ VCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQP+LLGKEP   AP NGGSPLPSDESNLEPP+TNGNGKL  +SVNEDTTTSCTEDSMDAKAAS   P TPATPASPSDNSDSA+STPRAKR IEEASSAEENSLG++   +APP+AKKLREATH
Sbjct:    1 MIHEELVQLMKWKQARGRFYPQLSYLIKVNTPRAVMQETKKAFKKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECIQAIPEMEGSDYTAKEYLNFVKHIRNVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPQLLGKEPALPAPANGGSPLPSDESNLEPPATNGNGKL-VESVNEDTTTSCTEDSMDAKAASPGTPATPATPASPSDNSDSAVSTPRAKRQIEEASSAEENSLGEAPAPEAPPMAKKLREATH 269          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|910332072|ref|XP_013169384.1| (PREDICTED: uncharacterized protein LOC106119073 isoform X1 [Papilio xuthus])

HSP 1 Score: 461.455 bits (1186), Expect = 5.838e-162
Identity = 243/270 (90.00%), Postives = 255/270 (94.44%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSAPTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAAS---PPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARG+FYPQLSYLIKVNTPRAVMQETKKAF+KLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTAKEYLNFVKHI+ VCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQP+LLGKEP   AP NGGSPLPSDESNLEPP+TNGNGKL  +SVNEDTTTSCTEDSMDAKAAS   P TPATPASPSDNSDSA+STPRAKR IEEASSAEENSLG++   +APP+AKKLREATH
Sbjct:   68 MIHEELVQLMKWKQARGRFYPQLSYLIKVNTPRAVMQETKKAFKKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECIQAIPEMEGSDYTAKEYLNFVKHIRNVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPQLLGKEPALPAPANGGSPLPSDESNLEPPATNGNGKL-VESVNEDTTTSCTEDSMDAKAASPGTPATPATPASPSDNSDSAVSTPRAKRQIEEASSAEENSLGEAPAPEAPPMAKKLREATH 336          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|930660753|gb|KPJ02728.1| (hypothetical protein RR46_09931 [Papilio xuthus])

HSP 1 Score: 460.299 bits (1183), Expect = 2.035e-161
Identity = 242/270 (89.63%), Postives = 254/270 (94.07%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSAPTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAAS---PPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARG+FYPQLSYLIKVNTPRAVMQETKKAF+KLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTAKEYLNFVKHI+ VCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQP+LLGKEP   AP NGGSPLPSDESNLEPP+TNGNGKL  +SVNEDTTTSCTEDSMDAKA S   P TPATPASPSDNSDSA+STPRAKR IEEASSAEENSLG++   +APP+AKKLREATH
Sbjct:   68 MIHEELVQLMKWKQARGRFYPQLSYLIKVNTPRAVMQETKKAFKKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECIQAIPEMEGSDYTAKEYLNFVKHIRNVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPQLLGKEPALPAPANGGSPLPSDESNLEPPATNGNGKL-VESVNEDTTTSCTEDSMDAKAVSPGTPATPATPASPSDNSDSAVSTPRAKRQIEEASSAEENSLGEAPAPEAPPMAKKLREATH 336          
BLAST of HiSeq13057 vs. genbank:protein
Match: gi|512912176|ref|XP_004927592.1| (PREDICTED: uncharacterized protein LOC101735385 isoform X2 [Bombyx mori])

HSP 1 Score: 456.447 bits (1173), Expect = 4.917e-160
Identity = 235/270 (87.04%), Postives = 246/270 (91.11%), Query Frame = 0
Query:    1 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTAKEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPELLGKEPNTSAPTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTEDSMDAKAAS---PPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDSMDAQAPPVAKKLREATH 267
            MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADEC+QAIPEMEGSDYTA+EYLNFV HI+ VCDRLN+EQNGCGKKW PHMVELALWTHNIVSDLQP+LLGKEPN     NGGSPLPSDESNLEPP+T  NGKL  D VNEDTTTSCTEDSMDAKAAS   P TPATPASPSDNSDSA+STPR KR +EE SSAEENSLGDS +A  P +AKKLR+ATH
Sbjct:   68 MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVGTATASALLAAASPEIAPFMADECVQAIPEMEGSDYTAREYLNFVSHIRNVCDRLNEEQNGCGKKWFPHMVELALWTHNIVSDLQPQLLGKEPNNRPAANGGSPLPSDESNLEPPAT--NGKLVTDCVNEDTTTSCTEDSMDAKAASPSTPATPATPASPSDNSDSAVSTPRTKRQLEEGSSAEENSLGDSSEATLPNIAKKLRKATH 335          
The following BLAST results are available for this feature:
BLAST of HiSeq13057 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913301304|ref|XP_013199965.1|6.786e-16892.91PREDICTED: uncharacterized protein LOC106142662 [A... [more]
gi|943972529|ref|XP_014367747.1|3.964e-16790.74PREDICTED: uncharacterized protein LOC106718229 is... [more]
gi|943972532|ref|XP_014367748.1|1.020e-16589.74PREDICTED: uncharacterized protein LOC106718229 is... [more]
gi|943972526|ref|XP_014367746.1|4.644e-16589.74PREDICTED: uncharacterized protein LOC106718229 is... [more]
gi|512912180|ref|XP_004927593.1|2.262e-16487.78PREDICTED: uncharacterized protein LOC101735385 is... [more]
gi|827549902|ref|XP_012547006.1|9.522e-16487.78PREDICTED: uncharacterized protein LOC101735385 is... [more]
gi|910332075|ref|XP_013169385.1|2.868e-16290.00PREDICTED: uncharacterized protein LOC106119073 is... [more]
gi|910332072|ref|XP_013169384.1|5.838e-16290.00PREDICTED: uncharacterized protein LOC106119073 is... [more]
gi|930660753|gb|KPJ02728.1|2.035e-16189.63hypothetical protein RR46_09931 [Papilio xuthus][more]
gi|512912176|ref|XP_004927592.1|4.917e-16087.04PREDICTED: uncharacterized protein LOC101735385 is... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR21521UNCHARACTERIZEDcoord: 1..152
NoneNo IPR availablePANTHERPTHR21521:SF0DNA BINDING PROTEINcoord: 1..152

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13057HiSeq13057Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13057_p ID=HiSeq13057_p|Name=HiSeq13057|organism=Ostrinia scapulalis|type=polypeptide|length=267bp
MIHEELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIE
SAMTALSNLKGVGTATASALLAAASPEIAPFMADECLQAIPEMEGSDYTA
KEYLNFVKHIKTVCDRLNKEQNGCGKKWSPHMVELALWTHNIVSDLQPEL
LGKEPNTSAPTNGGSPLPSDESNLEPPSTNGNGKLAADSVNEDTTTSCTE
DSMDAKAASPPTPATPASPSDNSDSALSTPRAKRPIEEASSAEENSLGDS
MDAQAPPVAKKLREATH
back to top