HiSeq13060_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13060
Unique NameHiSeq13060_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length206
Homology
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|914562946|gb|KOB68965.1| (Uncharacterized protein OBRU01_11082 [Operophtera brumata])

HSP 1 Score: 184.496 bits (467), Expect = 7.365e-54
Identity = 124/260 (47.69%), Postives = 141/260 (54.23%), Query Frame = 0
Query:    4 CYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPA---PRQKCSRPPPAPRQSSSCAA---PPNCCPTCCRPMKTK---YV--------------------IPCYRYEDGRI----------------------------VKTLPVTAFKRNGMQDQEHSKLLGTTNFLVRHPRDVSIECDICTNPVKVADPAKVPPCQAKPVLGCGLLKKKPIEVSLEDIL 204
            CYPE+CG Y+V PML+APC PT  CEDP VC+PCLPRCPKGQ+VYCCEK PP  P ++  C  D    D       P + C    PAP + SS  A       C + C+P+K K   YV                    I  YR     +                            V+ LPVTAFKRNGMQDQEHSK LG  NFL R PRDVSIECD+ TNPVKV DPAKVPPC A  VLGC LLKKKPIE +   +L
Sbjct:    3 CYPEECGGYSVIPMLMAPCYPTNRCEDPSVCFPCLPRCPKGQLVYCCEKIPPKAPTKTPKCHDDSYDHDSHRKDCCPPRHCRPRSPAPTRQSSYKALKESDTSCHSGCKPVKAKYEQYVPSRHGRLPRSAYRRNGMQDQIHGYRGATQFLCAGDCSQGCCVFSAIEPLRTIFPRVTQEVRQLPVTAFKRNGMQDQEHSKALGAANFLSRCPRDVSIECDVITNPVKVGDPAKVPPCTACSVLGCCLLKKKPIEHNQPTVL 262          
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|909560494|ref|XP_013135338.1| (PREDICTED: keratin-associated protein 10-10-like isoform X3 [Papilio polytes])

HSP 1 Score: 125.176 bits (313), Expect = 3.763e-33
Identity = 77/169 (45.56%), Postives = 96/169 (56.80%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPM------KTKYVIPCYRYEDGRIVKTLPVTAFKRNGMQDQEHSKLLGTTNFLVRHPRDVSIECD 163
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P                 P  R+ C         +  C  P   CPTC +P         KYV+PCYRYEDGRIV+ LPV+AFKRNG+QDQEHSKLLGT NFLVR   D++I+CD
Sbjct:    1 MDCCFVNECERFAVTPVLMSP--QVKCCESAPLYVPCC----NDKLVYCCEKIRPCT---------------PVARKVCYDSNCDHTCTLCCEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVQNLPVSAFKRNGLQDQEHSKLLGTANFLVRCRNDIAIDCD 148          
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|910346517|ref|XP_013177167.1| (PREDICTED: uncharacterized protein LOC106124756 isoform X3 [Papilio xuthus])

HSP 1 Score: 125.176 bits (313), Expect = 4.286e-33
Identity = 80/172 (46.51%), Postives = 100/172 (58.14%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRIVKTLPVTAFKRNGMQDQEHSKLLGTTNFLVRHPRDVSIECD 163
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRIV+ LPV+AFKRNGMQDQEHSKLLGT NFL R   D++I+CD
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVQNLPVSAFKRNGMQDQEHSKLLGTANFLYRCRNDIAIDCD 148          
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|913331014|ref|XP_013197060.1| (PREDICTED: uncharacterized protein LOC106140080 [Amyelois transitella])

HSP 1 Score: 126.331 bits (316), Expect = 5.254e-33
Identity = 77/165 (46.67%), Postives = 99/165 (60.00%), Query Frame = 0
Query:    1 MACCYPED-CGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP------PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPMKTKYVIPCYRYEDGRIVK-------TLPVTAFKRNGMQDQEHSKLLGTTNFL 151
            M CC+  D C ++AVTP+L+ PC P KC EDPP+CYPCLP C KG+++YCCEKR P      PR     + ++ C      P    SR PP  R +S       CC   C+P++TKYVIPCYRYEDGRI +        LP++A++RNGMQDQ H    G   +L
Sbjct:    1 MECCFDIDGCEDFAVTPVLVTPCYPQKCAEDPPMCYPCLPGCAKGKLMYCCEKRAPRAPARTPRDGDR-DRNQDCSHARNMP----SREPPPQRDNS-------CCQPTCKPVRTKYVIPCYRYEDGRIERYVPTRHGRLPMSAYRRNGMQDQIHG-YRGAIRYL 152          
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|357606285|gb|EHJ64999.1| (hypothetical protein KGM_05256 [Danaus plexippus])

HSP 1 Score: 124.405 bits (311), Expect = 3.026e-31
Identity = 79/162 (48.77%), Postives = 104/162 (64.20%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESD-EGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTC---CRPMKTKYVIPCYRYEDGRIVKT-------LPVTAFKRNGMQDQEHSKLLGTTNFL 151
            MAC + E+ G YAVTPML++P    KCCE PP+CYPCLPRCPKGQ++YCCEK P  + S++ +S+ E CC+  P   +K   PP    + +SC      C  C   C+ +KTKYVIPCYRYEDGRI +        LP++A++RNG+QDQ H    G   +L
Sbjct:    1 MACSF-EELG-YAVTPMLVSPFHAEKCCEAPPICYPCLPRCPKGQIIYCCEK-PLQKCSRTSDSNYEDCCNEKP---KKLMPPPVTCNEQASCPRHEQYCSPCHDHCKQVKTKYVIPCYRYEDGRIERYVPTRHGRLPMSAYRRNGVQDQIHG-YRGAIRYL 155          
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|909560489|ref|XP_013135336.1| (PREDICTED: keratin-associated protein 10-10-like isoform X1 [Papilio polytes])

HSP 1 Score: 85.5001 bits (210), Expect = 1.456e-17
Identity = 59/162 (36.42%), Postives = 82/162 (50.62%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPM------KTKYVIPCYRYEDGRIVKTLPVTAFKRNGMQDQEHSKLLGTTNFLVRHPR 156
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P                 P  R+ C         +  C  P   CPTC +P         KYV+PCYRYEDGRIV  +P +A KRNG+QD ++++  G  ++L + P 
Sbjct:    1 MDCCFVNECERFAVTPVLMSP--QVKCCESAPLYVPCC----NDKLVYCCEKIRPCT---------------PVARKVCYDSNCDHTCTLCCEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVNVMPSSALKRNGIQDHKYTE-SGGVDYLCQMPN 140          
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|930667620|gb|KPJ08703.1| (hypothetical protein RR48_06191 [Papilio machaon])

HSP 1 Score: 80.1073 bits (196), Expect = 8.221e-15
Identity = 61/155 (39.35%), Postives = 79/155 (50.97%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRIVK-------TLPVTAFKRNGMQDQ 139
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI +        LP TA+KRNG+QDQ
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKICPTCRQPTGPPAKPAVKYVMPCYRYEDGRIEQFDSKVHGKLPATAYKRNGIQDQ 131          

HSP 2 Score: 68.1662 bits (165), Expect = 1.932e-10
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 0
Query:  120 GRIVKTLPVTAFKRNGMQDQEHSKLLGTTNFLVRHPRDVSIECD 163
               V+ LPV+AFKRNGMQDQEHSKLLGT NFL R   D++I+CD
Sbjct:  205 ANTVQNLPVSAFKRNGMQDQEHSKLLGTANFLYRCRNDIAIDCD 248          
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|910346511|ref|XP_013177165.1| (PREDICTED: uncharacterized protein LOC106124756 isoform X1 [Papilio xuthus])

HSP 1 Score: 78.5666 bits (192), Expect = 8.914e-15
Identity = 61/155 (39.35%), Postives = 79/155 (50.97%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRIVK-------TLPVTAFKRNGMQDQ 139
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI +        LP TA+KRNG+QDQ
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIEQFDSNIHGKLPATAYKRNGIQDQ 131          
BLAST of HiSeq13060 vs. genbank:protein
Match: gi|930652636|gb|KPI94975.1| (hypothetical protein RR46_11979 [Papilio xuthus])

HSP 1 Score: 80.1073 bits (196), Expect = 1.209e-14
Identity = 61/155 (39.35%), Postives = 79/155 (50.97%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRIVK-------TLPVTAFKRNGMQDQ 139
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI +        LP TA+KRNG+QDQ
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIEQFDSNIHGKLPATAYKRNGIQDQ 131          

HSP 2 Score: 67.781 bits (164), Expect = 3.174e-10
Identity = 30/44 (68.18%), Postives = 35/44 (79.55%), Query Frame = 0
Query:  120 GRIVKTLPVTAFKRNGMQDQEHSKLLGTTNFLVRHPRDVSIECD 163
               V+ LPV+AFKRNGMQDQEHSKLLGT NFL R   D++I+CD
Sbjct:  225 ANTVQNLPVSAFKRNGMQDQEHSKLLGTANFLYRCRNDIAIDCD 268          
The following BLAST results are available for this feature:
BLAST of HiSeq13060 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 9
Match NameE-valueIdentityDescription
gi|914562946|gb|KOB68965.1|7.365e-5447.69Uncharacterized protein OBRU01_11082 [Operophtera ... [more]
gi|909560494|ref|XP_013135338.1|3.763e-3345.56PREDICTED: keratin-associated protein 10-10-like i... [more]
gi|910346517|ref|XP_013177167.1|4.286e-3346.51PREDICTED: uncharacterized protein LOC106124756 is... [more]
gi|913331014|ref|XP_013197060.1|5.254e-3346.67PREDICTED: uncharacterized protein LOC106140080 [A... [more]
gi|357606285|gb|EHJ64999.1|3.026e-3148.77hypothetical protein KGM_05256 [Danaus plexippus][more]
gi|909560489|ref|XP_013135336.1|1.456e-1736.42PREDICTED: keratin-associated protein 10-10-like i... [more]
gi|930667620|gb|KPJ08703.1|8.221e-1539.35hypothetical protein RR48_06191 [Papilio machaon][more]
gi|910346511|ref|XP_013177165.1|8.914e-1539.35PREDICTED: uncharacterized protein LOC106124756 is... [more]
gi|930652636|gb|KPI94975.1|1.209e-1439.35hypothetical protein RR46_11979 [Papilio xuthus][more]
back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13060HiSeq13060Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13060_p ID=HiSeq13060_p|Name=HiSeq13060|organism=Ostrinia scapulalis|type=polypeptide|length=206bp
MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCC
EKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCP
TCCRPMKTKYVIPCYRYEDGRIVKTLPVTAFKRNGMQDQEHSKLLGTTNF
LVRHPRDVSIECDICTNPVKVADPAKVPPCQAKPVLGCGLLKKKPIEVSL
EDILDD
back to top