HiSeq13061_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13061
Unique NameHiSeq13061_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length173
Homology
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|913331014|ref|XP_013197060.1| (PREDICTED: uncharacterized protein LOC106140080 [Amyelois transitella])

HSP 1 Score: 105.531 bits (262), Expect = 2.244e-25
Identity = 64/129 (49.61%), Postives = 80/129 (62.02%), Query Frame = 0
Query:    1 MACCYPED-CGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP------PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPMKTKYVIPCYRYEDGRI 122
            M CC+  D C ++AVTP+L+ PC P KC EDPP+CYPCLP C KG+++YCCEKR P      PR     + ++ C      P    SR PP  R +S       CC   C+P++TKYVIPCYRYEDGRI
Sbjct:    1 MECCFDIDGCEDFAVTPVLVTPCYPQKCAEDPPMCYPCLPGCAKGKLMYCCEKRAPRAPARTPRDGDR-DRNQDCSHARNMP----SREPPPQRDNS-------CCQPTCKPVRTKYVIPCYRYEDGRI 117          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|357606285|gb|EHJ64999.1| (hypothetical protein KGM_05256 [Danaus plexippus])

HSP 1 Score: 105.916 bits (263), Expect = 1.277e-24
Identity = 67/126 (53.17%), Postives = 85/126 (67.46%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESD-EGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTC---CRPMKTKYVIPCYRYEDGRI 122
            MAC + E+ G YAVTPML++P    KCCE PP+CYPCLPRCPKGQ++YCCEK P  + S++ +S+ E CC+  P   +K   PP    + +SC      C  C   C+ +KTKYVIPCYRYEDGRI
Sbjct:    1 MACSF-EELG-YAVTPMLVSPFHAEKCCEAPPICYPCLPRCPKGQIIYCCEK-PLQKCSRTSDSNYEDCCNEKP---KKLMPPPVTCNEQASCPRHEQYCSPCHDHCKQVKTKYVIPCYRYEDGRI 120          

HSP 2 Score: 64.6994 bits (156), Expect = 2.448e-9
Identity = 32/47 (68.09%), Postives = 36/47 (76.60%), Query Frame = 0
Query:  123 TNQPTLLMRRACEVAVGARQRRKPFVLSTYSADPYNVEQRYHCEDER 169
             NQPT+LMRRACEVAVGAR RRKPFV S+YSA+      RY  +DER
Sbjct:  187 VNQPTILMRRACEVAVGARPRRKPFVTSSYSANAEEEVHRYMSQDER 233          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|914562946|gb|KOB68965.1| (Uncharacterized protein OBRU01_11082 [Operophtera brumata])

HSP 1 Score: 94.3597 bits (233), Expect = 6.204e-20
Identity = 59/120 (49.17%), Postives = 72/120 (60.00%), Query Frame = 0
Query:    4 CYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESD--------EGCCDPPPAPRQKCSRPPPAPRQSSSCAA---PPNCCPTCCRPMKTKY 110
            CYPE+CG Y+V PML+APC PT  CEDP VC+PCLPRCPKGQ+VYCCEK PP  P ++  C  D        + CC P     + C    PAP + SS  A       C + C+P+K KY
Sbjct:    3 CYPEECGGYSVIPMLMAPCYPTNRCEDPSVCFPCLPRCPKGQLVYCCEKIPPKAPTKTPKCHDDSYDHDSHRKDCCPP-----RHCRPRSPAPTRQSSYKALKESDTSCHSGCKPVKAKY 117          

HSP 2 Score: 72.4034 bits (176), Expect = 6.676e-12
Identity = 32/47 (68.09%), Postives = 39/47 (82.98%), Query Frame = 0
Query:  124 NQPTLLMRRACEVAVGARQRRKPFVLSTYSADPYNVEQRYHCEDERV 170
            NQPT+L RRACE+AVG R R+KPFV S+YSAD ++   RYHCEDER+
Sbjct:  257 NQPTVLTRRACEIAVGTRMRKKPFVESSYSADEFSEVHRYHCEDERL 303          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|910346515|ref|XP_013177166.1| (PREDICTED: keratin-associated protein 10-5-like isoform X2 [Papilio xuthus])

HSP 1 Score: 75.8702 bits (185), Expect = 3.125e-14
Identity = 57/144 (39.58%), Postives = 73/144 (50.69%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRITNQPTLLMRRACEVA 137
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P          +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI NQPT L + AC+VA
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICYDGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIINQPTCLTKHACKVA 122          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|909560491|ref|XP_013135337.1| (PREDICTED: keratin-associated protein 10-10-like isoform X2 [Papilio polytes])

HSP 1 Score: 75.0998 bits (183), Expect = 6.218e-14
Identity = 58/154 (37.66%), Postives = 74/154 (48.05%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPM------KTKYVIPCYRYEDGRITNQPTLLMRRACEVAVGARQRRKPFV 148
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P                 P  R+ C         +  C  P   CPTC +P         KYV+PCYRYEDGRI NQPT L + AC+VA      R P +
Sbjct:    1 MDCCFVNECERFAVTPVLMSP--QVKCCESAPLYVPCC----NDKLVYCCEKIRPCT---------------PVARKVCYDSNCDHTCTLCCEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIINQPTCLTKHACKVACSYPTPRLPSI 133          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|910346517|ref|XP_013177167.1| (PREDICTED: uncharacterized protein LOC106124756 isoform X3 [Papilio xuthus])

HSP 1 Score: 63.1586 bits (152), Expect = 1.624e-9
Identity = 56/161 (34.78%), Postives = 75/161 (46.58%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRIT-NQPTLLMRRACEVAVGARQRRKPFVLST 151
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI  N P    +R      G + +    +L T
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVQNLPVSAFKRN-----GMQDQEHSKLLGT 132          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|909560494|ref|XP_013135338.1| (PREDICTED: keratin-associated protein 10-10-like isoform X3 [Papilio polytes])

HSP 1 Score: 62.3882 bits (150), Expect = 3.276e-9
Identity = 50/139 (35.97%), Postives = 64/139 (46.04%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPM------KTKYVIPCYRYEDGRIT-NQPTLLMRR 132
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P                 P  R+ C         +  C  P   CPTC +P         KYV+PCYRYEDGRI  N P    +R
Sbjct:    1 MDCCFVNECERFAVTPVLMSP--QVKCCESAPLYVPCC----NDKLVYCCEKIRPCT---------------PVARKVCYDSNCDHTCTLCCEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVQNLPVSAFKR 118          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|909560489|ref|XP_013135336.1| (PREDICTED: keratin-associated protein 10-10-like isoform X1 [Papilio polytes])

HSP 1 Score: 62.3882 bits (150), Expect = 4.587e-9
Identity = 50/139 (35.97%), Postives = 66/139 (47.48%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPM------KTKYVIPCYRYEDGRITN-QPTLLMRR 132
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P                 P  R+ C         +  C  P   CPTC +P         KYV+PCYRYEDGRI N  P+  ++R
Sbjct:    1 MDCCFVNECERFAVTPVLMSP--QVKCCESAPLYVPCC----NDKLVYCCEKIRPCT---------------PVARKVCYDSNCDHTCTLCCEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVNVMPSSALKR 118          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|930667620|gb|KPJ08703.1| (hypothetical protein RR48_06191 [Papilio machaon])

HSP 1 Score: 63.1586 bits (152), Expect = 6.318e-9
Identity = 50/131 (38.17%), Postives = 65/131 (49.62%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPMK------TKYVIPCYRYEDGRI 122
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKICPTCRQPTGPPAKPAVKYVMPCYRYEDGRI 107          
BLAST of HiSeq13061 vs. genbank:protein
Match: gi|930652636|gb|KPI94975.1| (hypothetical protein RR46_11979 [Papilio xuthus])

HSP 1 Score: 62.7734 bits (151), Expect = 9.491e-9
Identity = 50/131 (38.17%), Postives = 65/131 (49.62%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPMK------TKYVIPCYRYEDGRI 122
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRI 107          
The following BLAST results are available for this feature:
BLAST of HiSeq13061 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 10
Match NameE-valueIdentityDescription
gi|913331014|ref|XP_013197060.1|2.244e-2549.61PREDICTED: uncharacterized protein LOC106140080 [A... [more]
gi|357606285|gb|EHJ64999.1|1.277e-2453.17hypothetical protein KGM_05256 [Danaus plexippus][more]
gi|914562946|gb|KOB68965.1|6.204e-2049.17Uncharacterized protein OBRU01_11082 [Operophtera ... [more]
gi|910346515|ref|XP_013177166.1|3.125e-1439.58PREDICTED: keratin-associated protein 10-5-like is... [more]
gi|909560491|ref|XP_013135337.1|6.218e-1437.66PREDICTED: keratin-associated protein 10-10-like i... [more]
gi|910346517|ref|XP_013177167.1|1.624e-934.78PREDICTED: uncharacterized protein LOC106124756 is... [more]
gi|909560494|ref|XP_013135338.1|3.276e-935.97PREDICTED: keratin-associated protein 10-10-like i... [more]
gi|909560489|ref|XP_013135336.1|4.587e-935.97PREDICTED: keratin-associated protein 10-10-like i... [more]
gi|930667620|gb|KPJ08703.1|6.318e-938.17hypothetical protein RR48_06191 [Papilio machaon][more]
gi|930652636|gb|KPI94975.1|9.491e-938.17hypothetical protein RR46_11979 [Papilio xuthus][more]
back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13061HiSeq13061Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13061_p ID=HiSeq13061_p|Name=HiSeq13061|organism=Ostrinia scapulalis|type=polypeptide|length=173bp
MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCC
EKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCP
TCCRPMKTKYVIPCYRYEDGRITNQPTLLMRRACEVAVGARQRRKPFVLS
TYSADPYNVEQRYHCEDERVSHR
back to top