HiSeq13064_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13064
Unique NameHiSeq13064_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length181
Homology
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|913331014|ref|XP_013197060.1| (PREDICTED: uncharacterized protein LOC106140080 [Amyelois transitella])

HSP 1 Score: 129.798 bits (325), Expect = 9.220e-35
Identity = 86/195 (44.10%), Postives = 112/195 (57.44%), Query Frame = 0
Query:    1 MACCYPED-CGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP------PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPMKTKYVIPCYRYEDGRI-------VNPLPSSALKRNGLQDQKFIESGGISYIRKSWREAIWSYCPITIPVKPMKKLPVLVTKK 181
            M CC+  D C ++AVTP+L+ PC P KC EDPP+CYPCLP C KG+++YCCEKR P      PR     + ++ C      P    SR PP  R +S       CC   C+P++TKYVIPCYRYEDGRI          LP SA +RNG+QDQ     G I Y+  +   A    C  TI V+P++K+   VT++
Sbjct:    1 MECCFDIDGCEDFAVTPVLVTPCYPQKCAEDPPMCYPCLPGCAKGKLMYCCEKRAPRAPARTPRDGDR-DRNQDCSHARNMP----SREPPPQRDNS-------CCQPTCKPVRTKYVIPCYRYEDGRIERYVPTRHGRLPMSAYRRNGMQDQIHGYRGAIRYLCAADTLAEKGCCVHTI-VEPLRKIYPRVTQE 182          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|357606285|gb|EHJ64999.1| (hypothetical protein KGM_05256 [Danaus plexippus])

HSP 1 Score: 126.331 bits (316), Expect = 1.860e-32
Identity = 84/193 (43.52%), Postives = 113/193 (58.55%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESD-EGCCDPPPA----PRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPMKTKYVIPCYRYEDGRI-------VNPLPSSALKRNGLQDQKFIESGGISYIRKSWREAIWSYCPITIPVKPMKKLPVLVTKK 181
            MAC + E+ G YAVTPML++P    KCCE PP+CYPCLPRCPKGQ++YCCEK P  + S++ +S+ E CC+  P     P   C+     PR    C+     C   C+ +KTKYVIPCYRYEDGRI          LP SA +RNG+QDQ     G I Y+         + C +   ++P+++L   VT++
Sbjct:    1 MACSF-EELG-YAVTPMLVSPFHAEKCCEAPPICYPCLPRCPKGQIIYCCEK-PLQKCSRTSDSNYEDCCNEKPKKLMPPPVTCNEQASCPRHEQYCSP----CHDHCKQVKTKYVIPCYRYEDGRIERYVPTRHGRLPMSAYRRNGVQDQIHGYRGAIRYLCAGSEN---NECLVYTAIEPIRRLYPKVTQE 183          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|909560489|ref|XP_013135336.1| (PREDICTED: keratin-associated protein 10-10-like isoform X1 [Papilio polytes])

HSP 1 Score: 122.094 bits (305), Expect = 6.041e-32
Identity = 76/187 (40.64%), Postives = 102/187 (54.55%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPM------KTKYVIPCYRYEDGRIVNPLPSSALKRNGLQDQKFIESGGISYIRKSWREAIWSYCPITIPVKPMKKLPVLVTKK 181
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P                 P  R+ C         +  C  P   CPTC +P         KYV+PCYRYEDGRIVN +PSSALKRNG+QD K+ ESGG+ Y+ +    ++WS  P  +P+KP+K++   VT K
Sbjct:    1 MDCCFVNECERFAVTPVLMSP--QVKCCESAPLYVPCC----NDKLVYCCEKIRPCT---------------PVARKVCYDSNCDHTCTLCCEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVNVMPSSALKRNGIQDHKYTESGGVDYLCQMPNTSLWSDKPFYMPIKPLKRIANTVTLK 166          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|914562946|gb|KOB68965.1| (Uncharacterized protein OBRU01_11082 [Operophtera brumata])

HSP 1 Score: 110.153 bits (274), Expect = 1.151e-25
Identity = 72/157 (45.86%), Postives = 89/157 (56.69%), Query Frame = 0
Query:    4 CYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPA---PRQKCSRPPPAPRQSSSCAA---PPNCCPTCCRPMKTKY--VIPCYRYEDGRIVNPLPSSALKRNGLQDQKFIESGGISYI 150
            CYPE+CG Y+V PML+APC PT  CEDP VC+PCLPRCPKGQ+VYCCEK PP  P ++  C  D    D       P + C    PAP + SS  A       C + C+P+K KY   +P      GR    LP SA +RNG+QDQ     G   ++
Sbjct:    3 CYPEECGGYSVIPMLMAPCYPTNRCEDPSVCFPCLPRCPKGQLVYCCEKIPPKAPTKTPKCHDDSYDHDSHRKDCCPPRHCRPRSPAPTRQSSYKALKESDTSCHSGCKPVKAKYEQYVPS---RHGR----LPRSAYRRNGMQDQIHGYRGATQFL 152          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|930667620|gb|KPJ08703.1| (hypothetical protein RR48_06191 [Papilio machaon])

HSP 1 Score: 97.4413 bits (241), Expect = 1.127e-21
Identity = 77/232 (33.19%), Postives = 104/232 (44.83%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRI---------------------------------------------VNPLPSSALKRNGLQDQKFIESGGISYIRKSWREAIWSYCPITIPVKPMKKLPVLV 178
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI                                             V  +PS+ALKRNG+QD ++ ESGG+SY+ +S   AIWS  P  +P+K  K++   V
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKICPTCRQPTGPPAKPAVKYVMPCYRYEDGRIEQFDSKVHGKLPATAYKRNGIQDQINGYRGARRDLCAVEHDGKYFVKVMPSTALKRNGIQDHEYNESGGVSYLCQSPNTAIWSDRPFYMPIKAFKRIANTV 208          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|909560494|ref|XP_013135338.1| (PREDICTED: keratin-associated protein 10-10-like isoform X3 [Papilio polytes])

HSP 1 Score: 90.1225 bits (222), Expect = 7.972e-20
Identity = 64/168 (38.10%), Postives = 80/168 (47.62%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCPTCCRPM------KTKYVIPCYRYEDGRIVNPLPSSALKRNGLQDQKFIESGGISYIRKSWREAIWSYC 162
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P                 P  R+ C         +  C  P   CPTC +P         KYV+PCYRYEDGRIV  LP SA KRNGLQDQ+  +  G +      R  I   C
Sbjct:    1 MDCCFVNECERFAVTPVLMSP--QVKCCESAPLYVPCC----NDKLVYCCEKIRPC---------------TPVARKVCYDSNCDHTCTLCCEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVQNLPVSAFKRNGLQDQEHSKLLGTANFLVRCRNDIAIDC 147          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|910346517|ref|XP_013177167.1| (PREDICTED: uncharacterized protein LOC106124756 isoform X3 [Papilio xuthus])

HSP 1 Score: 88.9669 bits (219), Expect = 2.071e-19
Identity = 66/171 (38.60%), Postives = 85/171 (49.71%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRIVNPLPSSALKRNGLQDQKFIESGGISYIRKSWREAIWSYC 162
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRIV  LP SA KRNG+QDQ+  +  G +      R  I   C
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIVQNLPVSAFKRNGMQDQEHSKLLGTANFLYRCRNDIAIDC 147          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|930652636|gb|KPI94975.1| (hypothetical protein RR46_11979 [Papilio xuthus])

HSP 1 Score: 80.8777 bits (198), Expect = 3.216e-15
Identity = 69/208 (33.17%), Postives = 95/208 (45.67%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGR-------IVNPLPSSALKRNGLQDQK-----------FIESGGISYIRKSWREAIWSYCPITIPVKPMKKLPVLVTKK 181
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGR       I   LP++A KRNG+QDQ             +E  G  ++  +       Y  IT  V P++ +P    K+
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIEQFDSNIHGKLPATAYKRNGIQDQINGYRGARRDLCAVEHDGKYFVYTAIEPFKRIYPRITHEVNPVRVMPSTALKR 184          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|910346511|ref|XP_013177165.1| (PREDICTED: uncharacterized protein LOC106124756 isoform X1 [Papilio xuthus])

HSP 1 Score: 78.1814 bits (191), Expect = 8.648e-15
Identity = 69/208 (33.17%), Postives = 94/208 (45.19%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPP--PRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGR-------IVNPLPSSALKRNGLQDQK-----------FIESGGISYIRKSWREAIWSYCPITIPVKPMKKLPVLVTKK 181
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P  P   + C   +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGR       I   LP++A KRNG+QDQ             +E  G  ++  +       Y  IT  V P++  P  +  K
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICY--DGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIEQFDSNIHGKLPATAYKRNGIQDQINGYRGARRDLCAVEHDGKYFVYTAIEPFKRIYPRITHEVNPVRLSPKKIYDK 184          
BLAST of HiSeq13064 vs. genbank:protein
Match: gi|910346515|ref|XP_013177166.1| (PREDICTED: keratin-associated protein 10-5-like isoform X2 [Papilio xuthus])

HSP 1 Score: 62.3882 bits (150), Expect = 4.682e-9
Identity = 49/131 (37.40%), Postives = 64/131 (48.85%), Query Frame = 0
Query:    1 MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCCEKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPN-CCPTCCRPM------KTKYVIPCYRYEDGRIVN 124
            M CC+  +C  +AVTP+L++P    KCCE  P+  PC       ++VYCCEK  P          +G CD                   + C+ PP   CPTC +P         KYV+PCYRYEDGRI+N
Sbjct:    1 MDCCFVNECERFAVTPVLVSP--QVKCCESAPIYVPCC----NDKVVYCCEKIRPCTPVARKICYDGNCD----------------HTCTLCSEPPQKFCPTCRQPTGPPAKPAVKYVMPCYRYEDGRIIN 109          
The following BLAST results are available for this feature:
BLAST of HiSeq13064 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 11
Match NameE-valueIdentityDescription
gi|913331014|ref|XP_013197060.1|9.220e-3544.10PREDICTED: uncharacterized protein LOC106140080 [A... [more]
gi|357606285|gb|EHJ64999.1|1.860e-3243.52hypothetical protein KGM_05256 [Danaus plexippus][more]
gi|909560489|ref|XP_013135336.1|6.041e-3240.64PREDICTED: keratin-associated protein 10-10-like i... [more]
gi|914562946|gb|KOB68965.1|1.151e-2545.86Uncharacterized protein OBRU01_11082 [Operophtera ... [more]
gi|930667620|gb|KPJ08703.1|1.127e-2133.19hypothetical protein RR48_06191 [Papilio machaon][more]
gi|909560494|ref|XP_013135338.1|7.972e-2038.10PREDICTED: keratin-associated protein 10-10-like i... [more]
gi|910346517|ref|XP_013177167.1|2.071e-1938.60PREDICTED: uncharacterized protein LOC106124756 is... [more]
gi|930652636|gb|KPI94975.1|3.216e-1533.17hypothetical protein RR46_11979 [Papilio xuthus][more]
gi|910346511|ref|XP_013177165.1|8.648e-1533.17PREDICTED: uncharacterized protein LOC106124756 is... [more]
gi|910346515|ref|XP_013177166.1|4.682e-937.40PREDICTED: keratin-associated protein 10-5-like is... [more]

Pages

back to top
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13064HiSeq13064Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13064_p ID=HiSeq13064_p|Name=HiSeq13064|organism=Ostrinia scapulalis|type=polypeptide|length=181bp
MACCYPEDCGEYAVTPMLIAPCLPTKCCEDPPVCYPCLPRCPKGQMVYCC
EKRPPPRQSQSCESDEGCCDPPPAPRQKCSRPPPAPRQSSSCAAPPNCCP
TCCRPMKTKYVIPCYRYEDGRIVNPLPSSALKRNGLQDQKFIESGGISYI
RKSWREAIWSYCPITIPVKPMKKLPVLVTKK
back to top