HiSeq13067_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13067
Unique NameHiSeq13067_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length210
Homology
The following BLAST results are available for this feature:
BLAST of HiSeq13067 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D3.30.60.30coord: 143..194
e-value: 4.4E-4
score: 19.6

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13067HiSeq13067Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13067_p ID=HiSeq13067_p|Name=HiSeq13067|organism=Ostrinia scapulalis|type=polypeptide|length=210bp
MEDVIFANVSQIKVSETTKASPIHDNCAMYIGKTCLHLRRYIYNYNRNYK
YNYNRYNYNDKHNYNRQYINKQHWRRPYRPIGRQAPINLSEYLTTQATFN
QEGPARHEFYDPSYGFEPYWADGDWVFVSPTKNPNVTETGLMCGDYCNPV
YIRYGRICGRNRKMEVKEFANYCVMRDSDCHDRELWHIAYRGKCRKDLPI
YRTQPTSTIQ
back to top