HiSeq13071_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13071
Unique NameHiSeq13071_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length401
Homology
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|913325965|ref|XP_013194369.1| (PREDICTED: visual system homeobox 2-like [Amyelois transitella])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 356/385 (92.47%), Postives = 367/385 (95.32%), Query Frame = 0
Query:    1 MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFENRDSDRVLNLSESREPRSPYTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEPDRAASASPTHHDVHDNQAQSSPGSSTTASSSAKGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQVRGLTRTPVSGSVDDDGPADIDVG 385
            MQAMSAN SAPRAPQRSPFAIQELLGLSDNR+SR+RYFE R+ DRVLNLSESREPR  YTPQF LPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPPGFPQIKSPYSP+SQ HLTAVRQ Y+G+PSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKS+EAAQHLKESGSEREGSEAEPDRA SASP HHDVHD QAQSSP SSTTASSSAKGRASPE  REMYEDPEAFRNNSIACLRAKAQEHQAR+LSNNLLLQVRGL+R+  S + DDDGPADIDVG
Sbjct:    1 MQAMSANTSAPRAPQRSPFAIQELLGLSDNRDSRDRYFEGRE-DRVLNLSESREPRG-YTPQFQLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPPGFPQIKSPYSPTSQPHLTAVRQFYAGVPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSMEAAQHLKESGSEREGSEAEPDRATSASPHHHDVHDTQAQSSPASSTTASSSAKGRASPE-TREMYEDPEAFRNNSIACLRAKAQEHQARLLSNNLLLQVRGLSRS-ASSACDDDGPADIDVG 381          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|827551417|ref|XP_012547588.1| (PREDICTED: visual system homeobox 2-like isoform X1 [Bombyx mori])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 347/390 (88.97%), Postives = 363/390 (93.08%), Query Frame = 0
Query:    1 MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFENRDSDRVLNLSESREPRSPYTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEPDRAASASPTHHDVHDNQAQSSPGSSTTASSSAKGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQVRGLTRTPVSG-SVDDDGPADIDVGTEPP 389
            MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFE+RD DRVLNLSESREPRS YTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLH PPGFPQIKSPYSP+SQ HLTAVRQ Y+G+ SL+AAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETIL SAKENDSVAPWLLGMHRKS+EAA+HLKESGSEREGSE E DRA S SP     H+NQAQSSP SSTTASSSA+GRASP+  R   +DP+AFRNNSIACLRAKAQEHQARILSNNLL+QVRGLTRTP+S  + +DDGP DIDVGTE P
Sbjct:    1 MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFESRDGDRVLNLSESREPRSAYTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHHPPGFPQIKSPYSPTSQPHLTAVRQFYTGVSSLEAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILNSAKENDSVAPWLLGMHRKSIEAARHLKESGSEREGSEPEADRATSTSP---HPHENQAQSSPASSTTASSSARGRASPDPAR---DDPDAFRNNSIACLRAKAQEHQARILSNNLLMQVRGLTRTPISTPNAEDDGPGDIDVGTEQP 384          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|827551419|ref|XP_012547589.1| (PREDICTED: visual system homeobox 2-like isoform X2 [Bombyx mori])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 341/390 (87.44%), Postives = 356/390 (91.28%), Query Frame = 0
Query:    1 MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFENRDSDRVLNLSESREPRSPYTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEPDRAASASPTHHDVHDNQAQSSPGSSTTASSSAKGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQVRGLTRTPVSG-SVDDDGPADIDVGTEPP 389
            MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFE+RD DRVLNLSESREPRS YTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLH PPGFPQIKSPYSP+SQ HLTAVRQ Y+G+ SL+AAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETIL SAKENDSVAPWL       LEAA+HLKESGSEREGSE E DRA S SP     H+NQAQSSP SSTTASSSA+GRASP+  R   +DP+AFRNNSIACLRAKAQEHQARILSNNLL+QVRGLTRTP+S  + +DDGP DIDVGTE P
Sbjct:    1 MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFESRDGDRVLNLSESREPRSAYTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHHPPGFPQIKSPYSPTSQPHLTAVRQFYTGVSSLEAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILNSAKENDSVAPWL-------LEAARHLKESGSEREGSEPEADRATSTSP---HPHENQAQSSPASSTTASSSARGRASPDPAR---DDPDAFRNNSIACLRAKAQEHQARILSNNLLMQVRGLTRTPISTPNAEDDGPGDIDVGTEQP 377          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|943944002|ref|XP_014355392.1| (PREDICTED: visual system homeobox 2-like isoform X1 [Papilio machaon])

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 321/441 (72.79%), Postives = 341/441 (77.32%), Query Frame = 0
Query:    1 MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFENRDSDRVLNLSE--SREPRSPYTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEPDRAASASP------THHDVHDNQAQSSPGSSTTASSSA-KGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQ------------------VRGLTRTPVSGSV------------------------DDDGPADIDVGTEPPP 390
            MQAMSA+A AP   QRSPFAIQELLGLS+ RE+RE   E          +   SR  R P+ PQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPP+LH PPGFPQIK PYSP++Q HLTAVRQ YSG+ SL+AAKDFTVDGLT YNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAE +R  SASP         D+ D+QAQSSPG S+T +SS+ KGRASPE GRE YED EAFRNNSIACLRAKAQEHQAR+LSNNLLLQ                  VRGL R   +                           +D+GP DIDVGTEPPP
Sbjct:    1 MQAMSASAGAP---QRSPFAIQELLGLSEGREAREGREERERERYEGEAAAAVSRYARGPFAPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPMLHAPPGFPQIKGPYSPTAQPHLTAVRQFYSGVSSLEAAKDFTVDGLTAYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEGERPLSASPHRPDRADRPDLQDHQAQSSPGGSSTTASSSAKGRASPEPGREPYEDHEAFRNNSIACLRAKAQEHQARLLSNNLLLQFKVLEQHSRQLHEDWRLQVRGLQRAGAAAMANAGAGAMGGAMGGALGGACAGAGSEDEGPLDIDVGTEPPP 438          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|910338413|ref|XP_013172809.1| (PREDICTED: visual system homeobox 2-like isoform X2 [Papilio xuthus])

HSP 1 Score: 477.633 bits (1228), Expect = 4.297e-166
Identity = 261/327 (79.82%), Postives = 275/327 (84.10%), Query Frame = 0
Query:   95 LLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEPDRAASASP------THHDVHDNQAQSSP-GSSTTASSSAKGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQVRGLTR---------------TPVSGSV---------DDDGPADIDVGTEPPP 390
            +LH PPGFPQIK PYSP++Q HLTAVRQ YSG+ SL+AAKDFTVDGLT YNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAE +R  SASP         D+ D+QAQSSP GSSTTASSSAKGRASPE GRE YED EAFRNNSIACLRAKAQEHQAR+LSNNLLLQVRGL R                 + G++         +D+GP DIDVGTEPPP
Sbjct:    1 MLHAPPGFPQIKGPYSPTAQPHLTAVRQFYSGVSSLEAAKDFTVDGLTAYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEGERPLSASPHRPDRADRPDLQDHQAQSSPGGSSTTASSSAKGRASPEPGREPYEDHEAFRNNSIACLRAKAQEHQARLLSNNLLLQVRGLQRAGAAAMAGAGAGAMSVAMGGTLGGACAGAGSEDEGPLDIDVGTEPPP 327          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|910338411|ref|XP_013172808.1| (PREDICTED: visual system homeobox 2-like isoform X1 [Papilio xuthus])

HSP 1 Score: 466.463 bits (1199), Expect = 1.791e-161
Identity = 256/345 (74.20%), Postives = 273/345 (79.13%), Query Frame = 0
Query:   95 LLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEPDRAASASP------THHDVHDNQAQSSPGSSTTASSSA-KGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQ------------------VRGLTR---------------TPVSGSV---------DDDGPADIDVGTEPPP 390
            +LH PPGFPQIK PYSP++Q HLTAVRQ YSG+ SL+AAKDFTVDGLT YNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAE +R  SASP         D+ D+QAQSSPG S+T +SS+ KGRASPE GRE YED EAFRNNSIACLRAKAQEHQAR+LSNNLLLQ                  VRGL R                 + G++         +D+GP DIDVGTEPPP
Sbjct:    1 MLHAPPGFPQIKGPYSPTAQPHLTAVRQFYSGVSSLEAAKDFTVDGLTAYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEGERPLSASPHRPDRADRPDLQDHQAQSSPGGSSTTASSSAKGRASPEPGREPYEDHEAFRNNSIACLRAKAQEHQARLLSNNLLLQFKVLEQHSRRLHEDWRLQVRGLQRAGAAAMAGAGAGAMSVAMGGTLGGACAGAGSEDEGPLDIDVGTEPPP 345          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|943944004|ref|XP_014355394.1| (PREDICTED: visual system homeobox 2-like isoform X2 [Papilio machaon])

HSP 1 Score: 444.891 bits (1143), Expect = 4.997e-153
Identity = 249/345 (72.17%), Postives = 264/345 (76.52%), Query Frame = 0
Query:   95 LLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEPDRAASASP------THHDVHDNQAQSSPGSSTTASSSA-KGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQ------------------VRGLTRTPVSGSV------------------------DDDGPADIDVGTEPPP 390
            +LH PPGFPQIK PYSP++Q HLT       G+ SL+AAKDFTVDGLT YNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAE +R  SASP         D+ D+QAQSSPG S+T +SS+ KGRASPE GRE YED EAFRNNSIACLRAKAQEHQAR+LSNNLLLQ                  VRGL R   +                           +D+GP DIDVGTEPPP
Sbjct:    1 MLHAPPGFPQIKGPYSPTAQPHLT-------GVSSLEAAKDFTVDGLTAYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKESGSEREGSEAEGERPLSASPHRPDRADRPDLQDHQAQSSPGGSSTTASSSAKGRASPEPGREPYEDHEAFRNNSIACLRAKAQEHQARLLSNNLLLQFKVLEQHSRQLHEDWRLQVRGLQRAGAAAMANAGAGAMGGAMGGALGGACAGAGSEDEGPLDIDVGTEPPP 338          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|768408910|ref|XP_011549920.1| (PREDICTED: visual system homeobox 2-like [Plutella xylostella])

HSP 1 Score: 390.963 bits (1003), Expect = 2.633e-132
Identity = 237/271 (87.45%), Postives = 247/271 (91.14%), Query Frame = 0
Query:    1 MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFENRDSDRVLNLSESRE-PRSPYTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPPGFPQIKSPYSPSSQQHLTAVRQLYS------------GMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGM 258
            MQAMSA+ SAPRAPQRSPFAIQELLGLSDNRESRERYFE RD+DRVLNLSESR+ PR+ YTPQF LPAS+ASRVAYAAAFNAQAAVAAAFLP PPLLHPPPGFPQIKSPYSP+SQ HLTAV++ YS            G+  L+AAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKEND VAPWLLG 
Sbjct:    1 MQAMSASQSAPRAPQRSPFAIQELLGLSDNRESRERYFE-RDNDRVLNLSESRDGPRTAYTPQFQLPASMASRVAYAAAFNAQAAVAAAFLPAPPLLHPPPGFPQIKSPYSPTSQPHLTAVQRFYSDFYQRHNEIGDKGVSPLEAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDQVAPWLLGF 270          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|1008435938|ref|XP_015834595.1| (PREDICTED: visual system homeobox 2 isoform X3 [Tribolium castaneum])

HSP 1 Score: 329.717 bits (844), Expect = 1.318e-106
Identity = 219/391 (56.01%), Postives = 249/391 (63.68%), Query Frame = 0
Query:   14 PQRSPFAIQELLGLSDNRESRERYFENRDSDRVLNLSESREPRSPYTPQFPLP--------ASVASRVAYAAAFNAQAAVAAAFLP-------------------------GPPLLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTV-DGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKE---SGSEREGSEAEPDRAASASPTHHDVHDNQAQSSPGSSTTASSSAKGRASPEGGREM----YEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQVR 363
            PQRSPFAIQELLGLSD   S+ R      S    N+   R  ++P    FP             ASR+AY   FNAQAAVAAAFLP                         G       PGF Q+K+ +S S            SG   LD +KDF+V DGL  +N KKKKKKRRHSRTIFTSYQL+ELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKEN+ VAPWLLGMHRKSLEAAQHLK+   + S+ E + +    A+  S T       Q Q  PG + +     + +              +DPEAFRNNSIACLRAKAQEH A++L++NL++QVR
Sbjct:   26 PQRSPFAIQELLGLSD---SQHRSPTAAVSAITPNVYPQRHLQAPTC--FPSEHGFNHHHMTMAASRMAY---FNAQAAVAAAFLPHNIAAAAGMNANAGGASPAAVLGLTGHQAGAAAPGFAQLKNSFSSS------GPGSCLSG--QLDNSKDFSVTDGLGSFN-KKKKKKRRHSRTIFTSYQLEELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENECVAPWLLGMHRKSLEAAQHLKDQDCTNSDHEETTSMRTEASDTSATSSQQTQQQQQPPPGHTVSGGDDDQQQQHVALATTQPPPYQDDPEAFRNNSIACLRAKAQEHSAKLLNHNLMMQVR 399          
BLAST of HiSeq13071 vs. genbank:protein
Match: gi|1059383451|ref|XP_017786540.1| (PREDICTED: visual system homeobox 2 isoform X3 [Nicrophorus vespilloides])

HSP 1 Score: 327.405 bits (838), Expect = 1.460e-105
Identity = 215/391 (54.99%), Postives = 251/391 (64.19%), Query Frame = 0
Query:   14 PQRSPFAIQELLGLSDNRESRERYFENRDSDRVLNLSESREPRSPYTPQFPLP--------ASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPPGFPQIKSPYSPSSQQHLTAVRQLYSGMPSL-----------------DAAKDFTV-DGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQHLKE----SGSEREGSEA----EPDRAASA-------SPTHHDVHDNQAQSSPGSSTTASSSAKGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQARILSNNLLLQVR 363
            PQRSPFAIQELLGL D   S+ R      S    N+   R  ++P    FP             ASR+AY   FNAQAAVAAAFLP    +    G     +  SP++   LT      SG   L                 D  KDF+V DGL+G+N KKKKKKRRHSRTIFTSYQL+ELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKEN+SVAPWLLGMHRKS+EAA+HLK+    S S+ E + +    E D +A++       SP+ H V+  + +               ++  +  +   EDPEAFRNNSIACLRAKAQEH A++L++ L+L  R
Sbjct:   26 PQRSPFAIQELLGLGD---SQHRSPTAAVSAITPNVYPQRHIQAPTC--FPSDHGFNHHHMTMAASRMAY---FNAQAAVAAAFLPHN--IAAAAGMNANPAGASPAAVLGLTHQASGASGFSQLKSSFGSSGPGSCLSGQLDNTKDFSVSDGLSGFN-KKKKKKRRHSRTIFTSYQLEELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENESVAPWLLGMHRKSMEAAEHLKDDNCNSNSDHEETTSMRTEESDTSATSGHQTQQLSPS-HTVNQVKKEHQQQQQHQQQQQQHQQSQQQQQQTYPEDPEAFRNNSIACLRAKAQEHSAKLLNHGLMLHAR 404          
The following BLAST results are available for this feature:
BLAST of HiSeq13071 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913325965|ref|XP_013194369.1|0.000e+092.47PREDICTED: visual system homeobox 2-like [Amyelois... [more]
gi|827551417|ref|XP_012547588.1|0.000e+088.97PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|827551419|ref|XP_012547589.1|0.000e+087.44PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|943944002|ref|XP_014355392.1|0.000e+072.79PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|910338413|ref|XP_013172809.1|4.297e-16679.82PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|910338411|ref|XP_013172808.1|1.791e-16174.20PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|943944004|ref|XP_014355394.1|4.997e-15372.17PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|768408910|ref|XP_011549920.1|2.633e-13287.45PREDICTED: visual system homeobox 2-like [Plutella... [more]
gi|1008435938|ref|XP_015834595.1|1.318e-10656.01PREDICTED: visual system homeobox 2 isoform X3 [Tr... [more]
gi|1059383451|ref|XP_017786540.1|1.460e-10554.99PREDICTED: visual system homeobox 2 isoform X3 [Ni... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0003677 DNA binding
molecular_function GO:0043565 sequence-specific DNA binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOXcoord: 153..215
e-value: 5.5E-25
score: 99.0
IPR001356Homeobox domainPFAMPF00046Homeoboxcoord: 154..210
e-value: 1.6E-21
score: 75.5
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 151..211
score: 18.998
IPR009057Homeodomain-likeGENE3D1.10.10.60coord: 148..214
e-value: 2.0E-27
score: 94.3
IPR009057Homeodomain-likeSUPERFAMILY46689Homeodomain-likecoord: 141..212
IPR003654OAR domainPFAMPF03826OARcoord: 334..351
e-value: 4.0E-7
score: 29.1
IPR003654OAR domainPROSITEPS50803OARcoord: 337..350
score: 9.607
NoneNo IPR availablePANTHERPTHR24329:SF169VISUAL SYSTEM HOMEOBOX 2coord: 1..52
NoneNo IPR availablePANTHERPTHR24329:SF169VISUAL SYSTEM HOMEOBOX 2coord: 122..357
NoneNo IPR availablePANTHERPTHR24329FAMILY NOT NAMEDcoord: 1..52
NoneNo IPR availablePANTHERPTHR24329FAMILY NOT NAMEDcoord: 122..357
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 186..209
IPR023339CVC domainPROSITEPS51496CVCcoord: 213..264
score: 23.037

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13071HiSeq13071Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13071_p ID=HiSeq13071_p|Name=HiSeq13071|organism=Ostrinia scapulalis|type=polypeptide|length=401bp
MQAMSANASAPRAPQRSPFAIQELLGLSDNRESRERYFENRDSDRVLNLS
ESREPRSPYTPQFPLPASVASRVAYAAAFNAQAAVAAAFLPGPPLLHPPP
GFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKK
KKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVW
FQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDS
VAPWLLGMHRKSLEAAQHLKESGSEREGSEAEPDRAASASPTHHDVHDNQ
AQSSPGSSTTASSSAKGRASPEGGREMYEDPEAFRNNSIACLRAKAQEHQ
ARILSNNLLLQVRGLTRTPVSGSVDDDGPADIDVGTEPPPLSPPRSPRGP
P
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: INTERPRO
TermDefinition
IPR023339CVC
IPR017970Homeobox_CS
IPR003654OAR_dom
IPR009057Homeodomain-like
IPR001356Homeobox_dom