HiSeq13072_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13072
Unique NameHiSeq13072_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length232
Homology
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|910338413|ref|XP_013172809.1| (PREDICTED: visual system homeobox 2-like isoform X2 [Papilio xuthus])

HSP 1 Score: 324.709 bits (831), Expect = 1.090e-108
Identity = 158/167 (94.61%), Postives = 162/167 (97.01%), Query Frame = 0
Query:   64 GFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 230
            GFPQIK PYSP++Q HLTAVRQ YSG+ SL+AAKDFTVDGLT YNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ
Sbjct:    7 GFPQIKGPYSPTAQPHLTAVRQFYSGVSSLEAAKDFTVDGLTAYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 173          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|913325965|ref|XP_013194369.1| (PREDICTED: visual system homeobox 2-like [Amyelois transitella])

HSP 1 Score: 327.02 bits (837), Expect = 1.277e-108
Identity = 158/164 (96.34%), Postives = 162/164 (98.78%), Query Frame = 0
Query:   67 QIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 230
            QIKSPYSP+SQ HLTAVRQ Y+G+PSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKS+EAAQ
Sbjct:  102 QIKSPYSPTSQPHLTAVRQFYAGVPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSMEAAQ 265          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|910338411|ref|XP_013172808.1| (PREDICTED: visual system homeobox 2-like isoform X1 [Papilio xuthus])

HSP 1 Score: 323.939 bits (829), Expect = 5.217e-108
Identity = 158/167 (94.61%), Postives = 162/167 (97.01%), Query Frame = 0
Query:   64 GFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 230
            GFPQIK PYSP++Q HLTAVRQ YSG+ SL+AAKDFTVDGLT YNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ
Sbjct:    7 GFPQIKGPYSPTAQPHLTAVRQFYSGVSSLEAAKDFTVDGLTAYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 173          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|827551417|ref|XP_012547588.1| (PREDICTED: visual system homeobox 2-like isoform X1 [Bombyx mori])

HSP 1 Score: 323.553 bits (828), Expect = 2.687e-107
Identity = 156/166 (93.98%), Postives = 162/166 (97.59%), Query Frame = 0
Query:   65 FPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 230
            FPQIKSPYSP+SQ HLTAVRQ Y+G+ SL+AAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETIL SAKENDSVAPWLLGMHRKS+EAA+
Sbjct:  102 FPQIKSPYSPTSQPHLTAVRQFYTGVSSLEAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILNSAKENDSVAPWLLGMHRKSIEAAR 267          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|943944002|ref|XP_014355392.1| (PREDICTED: visual system homeobox 2-like isoform X1 [Papilio machaon])

HSP 1 Score: 325.094 bits (832), Expect = 3.061e-107
Identity = 158/167 (94.61%), Postives = 162/167 (97.01%), Query Frame = 0
Query:   64 GFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 230
            GFPQIK PYSP++Q HLTAVRQ YSG+ SL+AAKDFTVDGLT YNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ
Sbjct:  100 GFPQIKGPYSPTAQPHLTAVRQFYSGVSSLEAAKDFTVDGLTAYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 266          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|943944004|ref|XP_014355394.1| (PREDICTED: visual system homeobox 2-like isoform X2 [Papilio machaon])

HSP 1 Score: 305.449 bits (781), Expect = 7.260e-101
Identity = 152/167 (91.02%), Postives = 156/167 (93.41%), Query Frame = 0
Query:   64 GFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 230
            GFPQIK PYSP++Q HLT       G+ SL+AAKDFTVDGLT YNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ
Sbjct:    7 GFPQIKGPYSPTAQPHLT-------GVSSLEAAKDFTVDGLTAYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 166          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|827551419|ref|XP_012547589.1| (PREDICTED: visual system homeobox 2-like isoform X2 [Bombyx mori])

HSP 1 Score: 305.064 bits (780), Expect = 4.560e-100
Identity = 148/159 (93.08%), Postives = 152/159 (95.60%), Query Frame = 0
Query:   65 FPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHR 223
            FPQIKSPYSP+SQ HLTAVRQ Y+G+ SL+AAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETIL SAKENDSVAPWLL   R
Sbjct:  102 FPQIKSPYSPTSQPHLTAVRQFYTGVSSLEAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILNSAKENDSVAPWLLEAAR 260          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|768408910|ref|XP_011549920.1| (PREDICTED: visual system homeobox 2-like [Plutella xylostella])

HSP 1 Score: 285.034 bits (728), Expect = 2.801e-93
Identity = 144/166 (86.75%), Postives = 149/166 (89.76%), Query Frame = 0
Query:   67 QIKSPYSPSSQQHLTAVRQLYS------------GMPSLDAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLG 220
            QIKSPYSP+SQ HLTAV++ YS            G+  L+AAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKEND VAPWLLG
Sbjct:  104 QIKSPYSPTSQPHLTAVQRFYSDFYQRHNEIGDKGVSPLEAAKDFTVDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDQVAPWLLG 269          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|1059383451|ref|XP_017786540.1| (PREDICTED: visual system homeobox 2 isoform X3 [Nicrophorus vespilloides])

HSP 1 Score: 261.922 bits (668), Expect = 1.329e-82
Identity = 128/139 (92.09%), Postives = 135/139 (97.12%), Query Frame = 0
Query:   93 LDAAKDFTV-DGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 230
            LD  KDF+V DGL+G+N KKKKKKRRHSRTIFTSYQL+ELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKEN+SVAPWLLGMHRKS+EAA+
Sbjct:  157 LDNTKDFSVSDGLSGFN-KKKKKKRRHSRTIFTSYQLEELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENESVAPWLLGMHRKSMEAAE 294          
BLAST of HiSeq13072 vs. genbank:protein
Match: gi|1059383447|ref|XP_017786538.1| (PREDICTED: visual system homeobox 2 isoform X1 [Nicrophorus vespilloides])

HSP 1 Score: 262.307 bits (669), Expect = 1.465e-82
Identity = 128/139 (92.09%), Postives = 135/139 (97.12%), Query Frame = 0
Query:   93 LDAAKDFTV-DGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENDSVAPWLLGMHRKSLEAAQ 230
            LD  KDF+V DGL+G+N KKKKKKRRHSRTIFTSYQL+ELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKEN+SVAPWLLGMHRKS+EAA+
Sbjct:  167 LDNTKDFSVSDGLSGFN-KKKKKKRRHSRTIFTSYQLEELEKAFKDAHYPDVYAREMLSLKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPLPETILKSAKENESVAPWLLGMHRKSMEAAE 304          
The following BLAST results are available for this feature:
BLAST of HiSeq13072 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910338413|ref|XP_013172809.1|1.090e-10894.61PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|913325965|ref|XP_013194369.1|1.277e-10896.34PREDICTED: visual system homeobox 2-like [Amyelois... [more]
gi|910338411|ref|XP_013172808.1|5.217e-10894.61PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|827551417|ref|XP_012547588.1|2.687e-10793.98PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|943944002|ref|XP_014355392.1|3.061e-10794.61PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|943944004|ref|XP_014355394.1|7.260e-10191.02PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|827551419|ref|XP_012547589.1|4.560e-10093.08PREDICTED: visual system homeobox 2-like isoform X... [more]
gi|768408910|ref|XP_011549920.1|2.801e-9386.75PREDICTED: visual system homeobox 2-like [Plutella... [more]
gi|1059383451|ref|XP_017786540.1|1.329e-8292.09PREDICTED: visual system homeobox 2 isoform X3 [Ni... [more]
gi|1059383447|ref|XP_017786538.1|1.465e-8292.09PREDICTED: visual system homeobox 2 isoform X1 [Ni... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
molecular_function GO:0003677 DNA binding
molecular_function GO:0043565 sequence-specific DNA binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOXcoord: 116..178
e-value: 5.5E-25
score: 99.0
IPR001356Homeobox domainPFAMPF00046Homeoboxcoord: 117..173
e-value: 6.4E-22
score: 76.8
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 114..174
score: 18.998
IPR009057Homeodomain-likeGENE3D1.10.10.60coord: 111..177
e-value: 7.7E-28
score: 95.6
IPR009057Homeodomain-likeSUPERFAMILY46689Homeodomain-likecoord: 104..175
NoneNo IPR availablePANTHERPTHR24329:SF169VISUAL SYSTEM HOMEOBOX 2coord: 108..232
NoneNo IPR availablePANTHERPTHR24329FAMILY NOT NAMEDcoord: 108..232
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 6..30
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 31..232
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..5
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 149..172
IPR023339CVC domainPROSITEPS51496CVCcoord: 176..227
score: 23.037

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13072HiSeq13072Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13072_p ID=HiSeq13072_p|Name=HiSeq13072|organism=Ostrinia scapulalis|type=polypeptide|length=232bp
FLLVFXIFYSIYLLVGLTQFYSFIASYIFYECVANFVKXAVNIISASPTN
RRMKKRKEQWIXXGFPQIKSPYSPSSQQHLTAVRQLYSGMPSLDAAKDFT
VDGLTGYNGKKKKKKRRHSRTIFTSYQLDELEKAFKDAHYPDVYAREMLS
LKTDLPEDRIQVWFQNRRAKWRKTEKCWGRSTIMAEYGLYGAMVRHSLPL
PETILKSAKENDSVAPWLLGMHRKSLEAAQXT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: INTERPRO
TermDefinition
IPR023339CVC
IPR017970Homeobox_CS
IPR009057Homeodomain-like
IPR001356Homeobox_dom