HiSeq13073_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13073
Unique NameHiSeq13073_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length149
Homology
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|914570706|gb|KOB74012.1| (putative CSL-type zinc finger domain-containing protein [Operophtera brumata])

HSP 1 Score: 171.785 bits (434), Expect = 1.483e-52
Identity = 84/129 (65.12%), Postives = 105/129 (81.40%), Query Frame = 0
Query:   19 DYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEV 147
            DYY VL+C++TASAEELKRSYQRL+LS HPDK+D ++SDE FLL+QKAWSVLR+P SRKQYDA LTCQEH+E+L+Y+T+ + +M     ED+Y Y+CRCGGTY L+ S   +   + IGCDECSFSI V
Sbjct:    3 DYYTVLQCDKTASAEELKRSYQRLLLSSHPDKND-DDSDEKFLLIQKAWSVLREPESRKQYDATLTCQEHTEVLLYDTVSLSDMTL-ASEDIYTYSCRCGGTYKLENS-EAIQKNIYIGCDECSFSILV 128          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|357609457|gb|EHJ66460.1| (hypothetical protein KGM_08230 [Danaus plexippus])

HSP 1 Score: 164.851 bits (416), Expect = 9.648e-50
Identity = 77/138 (55.80%), Postives = 106/138 (76.81%), Query Frame = 0
Query:   11 MANNTDFPDYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAA-KVVIGCDECSFSIEV 147
            M    +F DYYQ+L+ E++AS EELK+SYQRLVL+ HPDKS  N  DE F L+QKAWSVLRDP+SRKQYDAEL C E+++LL+Y+T+ + +MD++  E++Y Y CRC G Y+LD S    ++ +V+I C+ECSF ++V
Sbjct:    1 MEKAENFIDYYQILQSEKSASNEELKKSYQRLVLAFHPDKSG-NAEDEKFHLIQKAWSVLRDPISRKQYDAELACYENTDLLLYDTISLSDMDFNATEELYSYQCRCSGIYYLDASELFESSFEVIISCNECSFCVKV 137          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|768444848|ref|XP_011564295.1| (PREDICTED: dnaJ homolog subfamily C member 24 [Plutella xylostella])

HSP 1 Score: 164.466 bits (415), Expect = 2.046e-49
Identity = 80/147 (54.42%), Postives = 110/147 (74.83%), Query Frame = 0
Query:    4 FLKIIFIMANNTDFP-DYYQVLECERTASAEELKRSYQRLVLSLHPDKS--DQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEV 147
             + +   M + T+ P DYY++L+ +R AS EELK++YQRLVL+LHPDK+    + SD  FL++QKAW+VLRDP +RK YDAEL+C+EHS+LL+Y  + +++MDY   E+ Y YTCRCGG Y L+ +GS    KV+I CDECSFS+EV
Sbjct:    1 MVSMTMNMKDETERPVDYYEILQSDRKASVEELKKNYQRLVLTLHPDKNAVGCDKSDASFLMLQKAWTVLRDPETRKLYDAELSCEEHSDLLLYANIDLKDMDYLETEECYTYTCRCGGNYILE-AGSTDQIKVIIPCDECSFSVEV 146          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|913328674|ref|XP_013195861.1| (PREDICTED: DPH4 homolog [Amyelois transitella])

HSP 1 Score: 158.303 bits (399), Expect = 5.874e-47
Identity = 77/145 (53.10%), Postives = 107/145 (73.79%), Query Frame = 0
Query:    4 FLKIIFI-MANNTDFPDYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEV 147
             LK+I++ M  N    DYY+ L+C+R A+ +++K+SYQRL L++HPDK   + S++ FLL+Q+AWSVLR+P SRKQYDAEL+C EHSELL+Y+T+ + +M +     VY Y+CRCGGTYFLD       ++VV+GCD CS SI V
Sbjct:    7 ILKLIYLKMEENCTKVDYYKALQCDRNATIDDIKKSYQRLALTMHPDKMKGDESEKNFLLIQEAWSVLRNPDSRKQYDAELSCHEHSELLLYDTVSLSDMVHTN-SSVYTYSCRCGGTYFLDTHEYN-PSEVVLGCDACSLSILV 149          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|509181423|gb|JAA88832.1| (putative CSL-type zinc finger domain-containing protein [Pararge aegeria])

HSP 1 Score: 156.762 bits (395), Expect = 1.400e-46
Identity = 73/131 (55.73%), Postives = 96/131 (73.28%), Query Frame = 0
Query:   17 FPDYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEV 147
            F DYY++L+ ER AS E+LKRSYQRLVL  HPDK+  +  +  F L+QKAWS+L+DP SR+QYDAE  C E+ +LL+Y T+ I  M +D  ED Y Y CRC G Y+L+ +G   + KV+IGC+ECSFSI+V
Sbjct:    4 FIDYYKILQSERNASNEQLKRSYQRLVLLSHPDKAG-DGQEMKFHLIQKAWSILKDPTSRRQYDAEFACYENDQLLLYNTISISEMRFDAAEDAYTYPCRCNGVYYLE-AGELSSNKVIIGCNECSFSIQV 132          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|1063195456|gb|AON96653.1| (DPH4-like protein [Bicyclus anynana])

HSP 1 Score: 156.762 bits (395), Expect = 1.693e-46
Identity = 79/138 (57.25%), Postives = 101/138 (73.19%), Query Frame = 0
Query:   11 MANNTDFPDYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAA-KVVIGCDECSFSIEV 147
            MANNT F DYY++L  +R AS E+LKRSYQ LVL  HPDK      +E F  +QKAWSVL++P SR+QYDAEL C E+ +LL+YET+ +  M++D  EDVY Y CRC G Y+L+ S   + + +VVIGCDECSFSI+V
Sbjct:    1 MANNT-FLDYYRILRSDRKASNEDLKRSYQSLVLLFHPDKVG-GGQEEKFHTIQKAWSVLKEPESRRQYDAELACYENHQLLLYETITLSQMEFDTAEDVYTYQCRCNGIYYLEASELLICSNQVVIGCDECSFSIKV 136          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|930665046|gb|KPJ06177.1| (DPH4-like [Papilio machaon])

HSP 1 Score: 147.902 bits (372), Expect = 5.299e-43
Identity = 65/129 (50.39%), Postives = 96/129 (74.42%), Query Frame = 0
Query:   19 DYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEV 147
            DYY++L+C++ A+ EELKRSYQRL L+ HPDK   + ++E F ++QKAWSVLRDP SRK+YDA L+C+EH ELL+Y+++ + +++YD    +Y Y CRCGG Y +  S   +  K+ + C+ECS SI++
Sbjct:    7 DYYEILQCDKNATLEELKRSYQRLALTCHPDKKISSENNENFHIIQKAWSVLRDPQSRKEYDALLSCEEHRELLLYDSISVPDLNYDSCNSIYSYQCRCGGLYSV-TSSELVPPKIYVECNECSLSIQI 134          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|910352936|ref|XP_013180456.1| (PREDICTED: DPH4 homolog [Papilio xuthus])

HSP 1 Score: 145.206 bits (365), Expect = 5.143e-42
Identity = 65/129 (50.39%), Postives = 94/129 (72.87%), Query Frame = 0
Query:   19 DYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEV 147
            DYY++L+C+R A+ EELKR+YQRL L+ HPDK   +  +E FL +QKAW+VLRDP SRK+YDA L+C+EH ELL+Y+++ + +++Y+    VY Y CRCGG Y +  S   +  K  + C+ECS SI++
Sbjct:    7 DYYEILQCDRNATLEELKRNYQRLALTCHPDKKISSEDNENFLNIQKAWTVLRDPQSRKEYDALLSCEEHRELLLYDSISVPDLNYNSCSSVYTYQCRCGGLYSV-TSSELVPPKTYVECNECSLSIQI 134          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|930649236|gb|KPI91584.1| (DPH4-like [Papilio xuthus])

HSP 1 Score: 143.28 bits (360), Expect = 3.517e-41
Identity = 64/129 (49.61%), Postives = 93/129 (72.09%), Query Frame = 0
Query:   19 DYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEV 147
            DYY++L+C+R A+ EELKR+YQRL L+ HPDK   +  +E FL +QKAW+VLRDP SRK+YDA L+C+EH ELL+Y+++ + +++Y+     Y Y CRCGG Y +  S   +  K  + C+ECS SI++
Sbjct:    7 DYYEILQCDRNATLEELKRNYQRLALTCHPDKKISSEDNENFLNIQKAWTVLRDPQSRKEYDALLSCEEHRELLLYDSISVPDLNYNSCSSFYTYQCRCGGLYSV-TSSELVPPKTYVECNECSLSIQI 134          
BLAST of HiSeq13073 vs. genbank:protein
Match: gi|1126197482|ref|XP_019631924.1| (PREDICTED: dnaJ homolog subfamily C member 24-like [Branchiostoma belcheri])

HSP 1 Score: 106.301 bits (264), Expect = 2.488e-26
Identity = 61/139 (43.88%), Postives = 79/139 (56.83%), Query Frame = 0
Query:   17 FPDYYQVLECERTASAEELKRSYQRLVLSLHPDKSDQNNSDE-------LFLLVQKAWSVLRDPVSRKQYDAELTCQEHS-ELLIYETLPIQNMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEV 147
             PD Y +L+  + AS EELK+SYQRLVL  HPDK D++ S E       +F+ V KAW  L DP  RK+YDA L  +  S E  + E + + +MDYD  E VY Y CRCG  Y +     G    +VI C  CS ++ V
Sbjct:    9 IPDLYCLLQVPKGASYEELKQSYQRLVLKYHPDKIDRHQSPEDQAAAQDMFVAVDKAWKTLGDPTLRKEYDARLNEKTVSQEFPVDEEITLADMDYDEDEGVYSYPCRCGDDYSVCEDEVGDGRDMVICCSTCSLTVRV 147          
The following BLAST results are available for this feature:
BLAST of HiSeq13073 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914570706|gb|KOB74012.1|1.483e-5265.12putative CSL-type zinc finger domain-containing pr... [more]
gi|357609457|gb|EHJ66460.1|9.648e-5055.80hypothetical protein KGM_08230 [Danaus plexippus][more]
gi|768444848|ref|XP_011564295.1|2.046e-4954.42PREDICTED: dnaJ homolog subfamily C member 24 [Plu... [more]
gi|913328674|ref|XP_013195861.1|5.874e-4753.10PREDICTED: DPH4 homolog [Amyelois transitella][more]
gi|509181423|gb|JAA88832.1|1.400e-4655.73putative CSL-type zinc finger domain-containing pr... [more]
gi|1063195456|gb|AON96653.1|1.693e-4657.25DPH4-like protein [Bicyclus anynana][more]
gi|930665046|gb|KPJ06177.1|5.299e-4350.39DPH4-like [Papilio machaon][more]
gi|910352936|ref|XP_013180456.1|5.143e-4250.39PREDICTED: DPH4 homolog [Papilio xuthus][more]
gi|930649236|gb|KPI91584.1|3.517e-4149.61DPH4-like [Papilio xuthus][more]
gi|1126197482|ref|XP_019631924.1|2.488e-2643.88PREDICTED: dnaJ homolog subfamily C member 24-like... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 21..39
score: 40.3
coord: 55..75
score: 29.05
coord: 39..54
score: 36.93
IPR001623DnaJ domainSMARTSM00271DnaJcoord: 18..75
e-value: 2.1E-17
score: 73.8
IPR001623DnaJ domainGENE3D1.10.287.110coord: 8..83
e-value: 2.0E-21
score: 75.4
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 19..80
e-value: 5.2E-21
score: 74.0
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 19..83
score: 16.143
IPR001623DnaJ domainSUPERFAMILY46565Chaperone J-domaincoord: 7..83
IPR007872Zinc finger, DPH-typePFAMPF05207zf-CSLcoord: 98..148
e-value: 4.5E-11
score: 41.9
IPR007872Zinc finger, DPH-typePROSITEPS51074ZF_DPHcoord: 93..149
score: 13.679
NoneNo IPR availablePANTHERPTHR24078:SF168SUBFAMILY NOT NAMEDcoord: 1..121
NoneNo IPR availablePANTHERPTHR24078DNAJ HOMOLOG SUBFAMILY C MEMBERcoord: 1..121
NoneNo IPR availableSUPERFAMILY144217CSL zinc fingercoord: 92..148

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13073HiSeq13073Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13073_p ID=HiSeq13073_p|Name=HiSeq13073|organism=Ostrinia scapulalis|type=polypeptide|length=149bp
MXXFLKIIFIMANNTDFPDYYQVLECERTASAEELKRSYQRLVLSLHPDK
SDQNNSDELFLLVQKAWSVLRDPVSRKQYDAELTCQEHSELLIYETLPIQ
NMDYDPVEDVYMYTCRCGGTYFLDRSGSGMAAKVVIGCDECSFSIEVIL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR007872Znf_DHP
IPR001623DnaJ_domain