HiSeq13076_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq13076
Unique NameHiSeq13076_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length80
Homology
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|913298063|ref|XP_013190873.1| (PREDICTED: uncharacterized protein LOC106135184 [Amyelois transitella])

HSP 1 Score: 82.8037 bits (203), Expect = 8.135e-17
Identity = 44/84 (52.38%), Postives = 54/84 (64.29%), Query Frame = 0
Query:    4 CPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTNEGKTLRPP-------PPRPERDVQACMRSCPVTSEYNPV 80
            CP+TQE NPVCG++G  Y NPG+L CA  CGV+V L R   CPT+  ++   P        P P+  V  CMRSCPVTSEYNP+
Sbjct:  390 CPITQEYNPVCGTDGITYWNPGRLQCAVTCGVDVGLKRPSICPTSNSESSSVPTVPAANTTPSPQI-VATCMRSCPVTSEYNPI 472          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|512933010|ref|XP_004932685.1| (PREDICTED: uncharacterized protein LOC101737882 [Bombyx mori])

HSP 1 Score: 74.3294 bits (181), Expect = 8.585e-14
Identity = 41/86 (47.67%), Postives = 52/86 (60.47%), Query Frame = 0
Query:    1 MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCP---TNEGKT---LRPPPPRPERDVQACMRSCPVTSEYNPV 80
            + +CP T E  PVCG+NG  YQNP  + C + CGVNVE+ R   CP   TN+ +T   L P        VQ C++SCP TSE+NPV
Sbjct:  276 IKSCPTTTENKPVCGTNGVTYQNPSYIQCIRICGVNVEIHRRAPCPSSATNDVQTTAMLSPDELLLTPAVQFCIKSCPATSEFNPV 361          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|909565620|ref|XP_013138135.1| (PREDICTED: uncharacterized protein LOC106103038 [Papilio polytes])

HSP 1 Score: 64.6994 bits (156), Expect = 8.452e-12
Identity = 29/46 (63.04%), Postives = 33/46 (71.74%), Query Frame = 0
Query:    1 MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCP 46
            +LTCPVT E NPVCGSNG  Y NPG+L CA+ CG N+ L R   CP
Sbjct:   54 LLTCPVTAEYNPVCGSNGVTYSNPGRLLCAQACGENISLQRTAPCP 99          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|914557579|gb|KOB66223.1| (Agrin [Operophtera brumata])

HSP 1 Score: 67.781 bits (164), Expect = 1.922e-11
Identity = 36/77 (46.75%), Postives = 45/77 (58.44%), Query Frame = 0
Query:    4 CPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTNEGKTLRPPPPRPERDVQACMRSCPVTSEYNPV 80
            C  T E NPVCGS+   Y N G+L CA+YCG++V+L R   C         PP P     +QAC+ +C VT EYNPV
Sbjct:  102 CSTTLEYNPVCGSDNLTYPNIGRLECARYCGLDVKLTRKTACSV-------PPTPDFTSVIQACITTCSVTPEYNPV 171          

HSP 2 Score: 63.929 bits (154), Expect = 3.621e-10
Identity = 37/93 (39.78%), Postives = 51/93 (54.84%), Query Frame = 0
Query:    1 MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTNEGK-----------TLRPPPPRPER--DVQACMRSCPVTSEYNPV 80
            M  CP+T E+NPVCG++   Y NPGKL C ++CG++V + ++G C    GK           TL PP   P     +Q C+  CPV+ E  PV
Sbjct:  267 MQLCPMTPEINPVCGTDSVTYSNPGKLLCTQFCGLDVRVRKFGPC---LGKPIPNPQPCVCPTLPPPTEVPTNPTTIQDCINKCPVSQEMKPV 356          

HSP 3 Score: 61.6178 bits (148), Expect = 2.335e-9
Identity = 38/107 (35.51%), Postives = 51/107 (47.66%), Query Frame = 0
Query:    1 MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTNEGKTLRPPPPRPE---------------------------RDVQACMRSCPVTSEYNPV 80
            + +CPVT E NPVCG+N   Y N G+L+CA+ CGV+V++ R   C      +  PP P P+                              QAC+R+C  T EYNPV
Sbjct:   11 IASCPVTTEHNPVCGTNDVTYTNIGRLDCARDCGVDVQIKRRSPC------SKLPPSPSPDNGDNNGGNNNGGNNNGGNNNGGNNSGGERFQACIRNCSTTLEYNPV 111          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|801386644|ref|XP_012056584.1| (PREDICTED: uncharacterized protein LOC105619675 [Atta cephalotes])

HSP 1 Score: 65.855 bits (159), Expect = 2.019e-11
Identity = 28/47 (59.57%), Postives = 35/47 (74.47%), Query Frame = 0
Query:    2 LTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTN 48
            + CPVT E NPVCG++  +Y NPG L+CAK CG +VEL  YG+C TN
Sbjct:  143 INCPVTSEYNPVCGTDNADYTNPGSLDCAKNCGRDVELNYYGRCSTN 189          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|746870663|ref|XP_011066521.1| (PREDICTED: uncharacterized protein LOC105153407 [Acromyrmex echinatior])

HSP 1 Score: 63.929 bits (154), Expect = 4.438e-11
Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 0
Query:    1 MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTNE 49
            ++ CPVT E NPVCG++  +Y NPG+L CAK+CG +VEL  YG+C T+ 
Sbjct:  104 VINCPVTSEYNPVCGTDKADYINPGRLGCAKHCGRDVELNYYGRCSTSR 152          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|768412930|ref|XP_011568564.1| (PREDICTED: glutenin, high molecular weight subunit DY10-like isoform X2 [Plutella xylostella])

HSP 1 Score: 65.855 bits (159), Expect = 4.593e-11
Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 0
Query:    1 MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCP 46
            +  CPVT E NPVCGS+G+EY NPG+L+CA+ CG  V LAR G CP
Sbjct:  206 IQQCPVTSEFNPVCGSDGQEYSNPGRLDCARGCGRGVTLARSGPCP 251          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|509165899|gb|JAA81070.1| (protease inhibitor 1, partial [Pararge aegeria])

HSP 1 Score: 62.3882 bits (150), Expect = 4.949e-11
Identity = 28/43 (65.12%), Postives = 31/43 (72.09%), Query Frame = 0
Query:    4 CPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCP 46
            CPVT E NPVCGSNG  Y NPG+L CA+ CGV V L R  +CP
Sbjct:   46 CPVTSEYNPVCGSNGVTYDNPGRLGCAQACGVTVNLLRASRCP 88          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|350403811|ref|XP_003486911.1| (PREDICTED: uncharacterized protein LOC100741778 [Bombus impatiens])

HSP 1 Score: 63.1586 bits (152), Expect = 6.373e-11
Identity = 28/49 (57.14%), Postives = 34/49 (69.39%), Query Frame = 0
Query:    1 MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTNE 49
            + TC  T E NPVCGS+G EY NPG+L+CA  CG +V L  YGKC T +
Sbjct:   84 IATCLTTSEYNPVCGSDGVEYSNPGQLSCASACGKDVTLTHYGKCRTTK 132          
BLAST of HiSeq13076 vs. genbank:protein
Match: gi|357615225|gb|EHJ69543.1| (hypothetical protein KGM_22559 [Danaus plexippus])

HSP 1 Score: 65.855 bits (159), Expect = 8.327e-11
Identity = 37/88 (42.05%), Postives = 47/88 (53.41%), Query Frame = 0
Query:    1 MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTN---EGKTLRPPPP-----RPERDVQACMRSCPVTSEYNPV 80
            M  CP T E NPVCG++   Y N GKL CA+ CGV V+L R+  CP     E +      P        R  ++C+ SC  TSEYNP+
Sbjct:   42 MSLCPTTSEYNPVCGTDNITYNNIGKLYCAQACGVEVQLQRHMPCPKKDPLEDRYSTSDSPITTTTLDSRYFRSCLDSCITTSEYNPI 129          
The following BLAST results are available for this feature:
BLAST of HiSeq13076 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913298063|ref|XP_013190873.1|8.135e-1752.38PREDICTED: uncharacterized protein LOC106135184 [A... [more]
gi|512933010|ref|XP_004932685.1|8.585e-1447.67PREDICTED: uncharacterized protein LOC101737882 [B... [more]
gi|909565620|ref|XP_013138135.1|8.452e-1263.04PREDICTED: uncharacterized protein LOC106103038 [P... [more]
gi|914557579|gb|KOB66223.1|1.922e-1146.75Agrin [Operophtera brumata][more]
gi|801386644|ref|XP_012056584.1|2.019e-1159.57PREDICTED: uncharacterized protein LOC105619675 [A... [more]
gi|746870663|ref|XP_011066521.1|4.438e-1155.10PREDICTED: uncharacterized protein LOC105153407 [A... [more]
gi|768412930|ref|XP_011568564.1|4.593e-1163.04PREDICTED: glutenin, high molecular weight subunit... [more]
gi|509165899|gb|JAA81070.1|4.949e-1165.12protease inhibitor 1, partial [Pararge aegeria][more]
gi|350403811|ref|XP_003486911.1|6.373e-1157.14PREDICTED: uncharacterized protein LOC100741778 [B... [more]
gi|357615225|gb|EHJ69543.1|8.327e-1142.05hypothetical protein KGM_22559 [Danaus plexippus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002350Kazal domainSMARTSM00280KAZALcoord: 3..45
e-value: 0.0046
score: 22.9
IPR002350Kazal domainPFAMPF00050Kazal_1coord: 4..45
e-value: 1.9E-6
score: 27.6
IPR002350Kazal domainPROSITEPS51465KAZAL_2coord: 1..47
score: 10.098
NoneNo IPR availableGENE3D3.30.60.30coord: 4..46
e-value: 5.0E-10
score: 38.7
NoneNo IPR availableSUPERFAMILY100895Kazal-type serine protease inhibitorscoord: 4..46

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq13076HiSeq13076Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq13076_p ID=HiSeq13076_p|Name=HiSeq13076|organism=Ostrinia scapulalis|type=polypeptide|length=80bp
MLTCPVTQELNPVCGSNGEEYQNPGKLNCAKYCGVNVELARYGKCPTNEG
KTLRPPPPRPERDVQACMRSCPVTSEYNPV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR002350Kazal_dom